KEGG   Sinocyclocheilus grahami: 107600928Help
Entry
107600928         CDS       T04918                                 

Definition
(RefSeq) neuroendocrine convertase 1-like isoform X1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sgh01002]
    107600928
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sgh03110]
    107600928
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     107600928
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S8: subtilisin family
   107600928
Chaperones and folding catalysts [BR:sgh03110]
 Intramolecular chaperones
  Subtilisin family
   107600928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N DctP
Motif
Other DBs
NCBI-GeneID: 107600928
NCBI-ProteinID: XP_016148403
LinkDB All DBs
Position
Unknown
AA seq 766 aa AA seqDB search
MEERCRPMLLCSILALFCALVSSAVDRQYLNEWAVEIPGGYNNARSIADELGYKFVRQIG
ALENHYLFKRHSHPSRTKRSADHITKRLSEDDRVSWAEQQYEKRRAKRAPLGTECKDCSV
DKLFDDPMWNQQWYLQDTRMSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDI
YPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEISMQADNKKCGVGVAYNSKVGG
IRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRG
GKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSS
GDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEF
DPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHIPEKKQCIVRDETFQPR
PLKAAGEISIEIPTKACAGQANCVVSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLA
ERERDTSSNGFRNWAFMSVHSWGENPTGTWTLKITDTSGRMENEGQIISWKLILHGTSEK
PEHMKEARVYTPYNAVQNDRRGVEPMEDMIKQEAPTPAHKPEISSLVVPDSLPSAASISV
PEKNAEAPGSANLALLRLLQSAFNRQTPVVPQHALAVPPAPPKTFQPERIPPQKLYQALD
QLNRFSGSENGLFSDYSDNFYRAQPYRHRDDRLLQALFDMLGDDLQ
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagatgtcgtccaatgttgctgtgcagtattcttgctctgttctgtgcgctg
gtgtcctccgctgtggacagacagtatctgaacgaatgggcggtggagattccaggagga
tacaacaatgcccgatccatagccgacgagctcggatacaaattcgtccgacagattggg
gcgctggaaaaccattatttattcaaacggcacagtcaccctagcaggaccaaaagaagt
gcggatcatatcaccaaacgtctgtcggaagatgatagggtctcttgggctgaacagcag
tatgagaaacggagggccaaacgtgccccgctggggaccgaatgtaaggactgctcggtg
gacaaactcttcgacgaccctatgtggaatcaacagtggtatctgcaagacacccggatg
tcatcatccctgcccaaactggacctgcacgtgatcccggtctggaagaagggcattacg
ggcaaaggagtggtcattaccgtgctggatgatggcctcgagtggaaccacaccgacatt
taccctaactatgatcctgctgctagctatgattttaatgacaacgatccagatcccttt
cccagatacgactccaccaatgaaaacaagcatggtaccagatgtgctggagagatttcc
atgcaagcagacaacaagaaatgtggtgtcggtgtggcctacaactccaaagtaggaggg
atacgaatgctggatggaatcgtgacagatgccattgaagccagttccattggctttaac
cctgatcacgtggacatctacagcgctagctggggccctaatgatgacgggaagaccgtg
gaggggcctgggcgcctggcccagaaagcttttgagtatggtatccagaagggtcgtggt
gggaagggctccattttcgtctgggcgtctggtaacggtggtcgtcagggcgacaactgt
gattgtgatggatacacagacagtctgtacaccatctccatcagcagtgcatcccagcag
ggtttgtctccctggtacgctgagaaatgctcctctacactggccacggcctacagcagc
ggagactacaccgaccagagaattactagtgccgatttgcacaatgaatgcacagagacg
cacactggcacatctgcatctgctccattggctgctgggatatttgcactggctttggag
caaaatcctgatctgacctggcgagaccttcagcacttagtggtttggacgtctgagttt
gatcccctggccaataacccaggctggaaaaggaatggagctggtttgatggtcaacagt
cgttttgggtttggtctcctgaatgccaaagctctagtagatctggccgatcccaaagtc
tggaagcacattccggagaagaaacagtgcatcgtcagagatgagacgttccaaccaagg
ccattgaaggctgcaggtgagatatccattgagatccccactaaggcctgtgcaggacag
gcgaattgtgttgtatctttggagcatgtgcaggtggaggtcagcattgagtacacacgc
agaggagacctgcacatcacgctgacgtctccatcaggtaccaccacagtcctgctggcg
gagagagagagggacacgtcatccaacggtttccgaaactgggcctttatgtctgtgcac
agctggggagaaaaccccaccggcacttggaccctgaagattacagatacgtctggacgg
atggagaatgagggtcagattatcagctggaagttgattttgcacgggacgtctgagaag
ccagagcacatgaaggaggcgagggtttacacaccctacaatgctgtacaaaacgatcgc
agaggagtggaaccgatggaagacatgatcaagcaggaagctccgactccagctcacaaa
cctgaaatttcaagtctagtggtcccagactcactcccgtctgctgcttccatcagcgta
ccagaaaaaaatgcagaagctccaggctctgccaatctggccctgctgcgtctcctccag
tcggccttcaacaggcaaaccccggtggttcctcagcacgctctggcggttcctccggct
cctcccaagacctttcagcctgagaggatccccccgcagaagctgtaccaggccctcgac
cagctaaaccgcttcagtggctccgagaatggcctgttcagtgactacagcgacaacttc
tacagagcccaaccgtacagacacagagacgaccggctgctgcaggcactgtttgacatg
ctcggagacgacctgcagtga

DBGET integrated database retrieval system