KEGG   Sinocyclocheilus grahami: 107601379Help
Entry
107601379         CDS       T04918                                 

Definition
(RefSeq) histone deacetylase 4-like
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107601379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107601379
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107601379
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107601379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln TFIIA
Motif
Other DBs
NCBI-GeneID: 107601379
NCBI-ProteinID: XP_016149028
LinkDB All DBs
Position
Unknown
AA seq 1062 aa AA seqDB search
MPAVPSPSCCTLSEVFTASVRTFPDGLPSKEQPLKLLKPSGVNHIPPVDVSAVLPLQVPP
SAIPMDLRVDHQFALAPTDPAQREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQH
EAQLQEHVKHQQDLLALKHQQELLEHQRKLERHRQEQELEKQQREQKLQLLKNKERGQES
AVASTEVKMRLQEFVLNKKKALAQRSLNHCLPNDPRYWYGKTQHSSLDQSSPPQTGISTY
NHPVLGMYDPKDDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRKDGPITTAKKRSLD
MAESACSSAPGSGPSSPNNSSNNITNENGIAGSISSSPVEPSLVHRLTGREGPVSQLSLY
TSPSLPNITLGLPATGPSSVASGLQDGDRMAVPGLQPGIPITTPFMPGAHLPSYLAASTL
EREGGSAHNTLLQHMVQNSLVAGLGGVPLQSHSIHKLRQHRPLGRTQSAPLPQNAQALQQ
LVVQQQHQQFLEKHKQQFQQQQLHISKMMAKPNEPGRQHESHPEETEEELREHQGLGDST
EALPHGVTIKQEPPDEQDEEFQQREMQPEEELLFRQQALLLEQQRIHQLRNFQASMEAAG
LSVTFPGHRPLSRAQSSPASATFPIVVQEPPAKPRFTTGLVYDTLMQKHQCMCGNSNNHP
EHAGRIQSIWSRLQETGLRGQCECIRGRKATLEELQTVHTEPHVLLYGTNPLRQKLDSSV
TPMFVRLPCGGIGVDSDTIWNEVHSSSAARLAVGSVVDLVFKVASGELRNGFAVVRPPGH
HAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYSDPNVLYVSL
HRYDDGNFFPGSGAHDEVGIGPGMGFNVNMAFTGGLEPPMGDADYLAAFRTVVMPIANEF
APDVVLVSSGFDAVEGHLPPLGGYKLTAKCFGYLTKQLMGLAGGRLVLALEGGHDLTAIC
DASEACVSALLGNELDPLPEDVLQQRPNPNAIHSMEKVLEVHSKYWRSLQRSASTLGYSL
LEAQRCETEEAETVTAMASLSVANKHMGKRTEEEPMEEEPPL
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgttccctcaccatcctgttgtacgctttcagaagtctttacagcctctgtc
aggacatttccagatggacttcccagtaaagaacagccactgaaacttctgaagccatct
ggagtcaatcacattcctcctgttgatgtgagtgcggtgctgccactgcaagtgccgcct
tctgccatccccatggacctgcgtgtggatcaccagttcgccctggcgccgacggacccg
gcccagcgcgagcagcagctgcagcaggagcttctggccctcaagcagaaacagcagata
cagaggcagatcctgatcgcagagtttcagcggcagcacgagcagctctcacgccagcat
gaagcgcagctgcaggagcacgtcaagcatcagcaggacctcctggccctgaaacatcag
caggagctcctggaacaccagcggaagttggagcgccatcgtcaggagcaggagctggag
aaacagcagcgggaacagaagctccagttactcaaaaacaaagaacgcggccaagagagc
gctgtggcgagcactgaggtgaagatgaggttgcaggagttcgtcctcaacaagaagaaa
gcgctggcccagaggagcctcaaccactgcctgcccaacgacccgcgctactggtacggg
aaaacccagcacagctccctggaccagagctcaccgcctcagacagggatttccacttac
aaccacccggtgctgggaatgtacgaccccaaagatgacttcccgctccgcaagacggca
tctgagcccaacctgaagctgcgatccaggctgaagcagaaagttacggagcgcaggagt
agcccgctgcttcggaggaaggatggtccgatcaccactgcaaagaagcgctctctggac
atggcagaatcggcatgcagcagtgctcctggttctggtccgagttcacccaacaacagt
tcaaacaatattaccaatgagaacggcatcgctggatcaatctccagcagtccagtggag
ccatctttggtgcacagactcacgggcagagagggtcctgttagccagctgtctctgtac
acatcgccctcccttcccaacatcaccctgggcctgccagccaccggcccctccagcgtg
gcatctggcctacaggatggtgacagaatggctgtgccaggcttgcagccaggaataccc
ataaccactccgttcatgccaggagcccacctgccttcttacctggccgcgtccacctta
gagcgggagggtggctcagcacacaacactctcctgcagcatatggtacagaactccctg
gtcgcaggcctggggggcgtgcccctgcagtcgcattccatccacaagctccggcagcat
cggcccctcggacgcacgcagtcggcccccctgccccagaatgcccaggcgctgcagcag
ctggtggttcaacagcaacaccagcagttcctggaaaaacacaagcaacagttccagcag
cagcagcttcacatcagcaagatgatggctaagccgaacgagccgggccgacagcatgag
agccacccggaggagacggaggaggagctgcgggagcaccagggcctgggcgactccacg
gaggctcttcctcacggggtcaccatcaaacaggaacctccggatgagcaggatgaagag
ttccagcagagagagatgcaacccgaggaagagctgctcttcagacagcaagctctcctg
ttggagcaacagaggatccatcagctgaggaactttcaggcatccatggaagcggccggt
ctgtctgtgaccttcccaggccatcggcccctgtccagagcacaatcatccccggcctct
gcgacctttcccattgtggtgcaggaacctccagccaaaccgcgctttaccaccggtctg
gtgtacgacaccctgatgcagaaacaccagtgcatgtgtggaaacagtaacaaccacccc
gaacacgccgggcgcatccagagcatctggtcacgactgcaggagacgggactgcgcggc
cagtgtgagtgtattcgaggcaggaaagccactctggaggagctacagacggtccacact
gagcctcatgtgctgctttacggaaccaaccctctcagacagaaactggacagctcagtg
acacccatgttcgtgagactgccgtgcggaggaatcggggttgacagtgacactatctgg
aatgaagttcactcgtccagtgctgctcgtctggctgtgggatctgtagtggatctggtg
tttaaagtggcttcaggagagctgaggaacggctttgctgtggtgcgacctccaggacat
cacgctgaggagagcactcccatgggattttgctatttcaactcggtcgccattgcagcc
aaactcctgcagcagagactcaacgtcagtaagattctcattgtggactgggatgttcac
catggaaatgggactcaacaggccttctacagtgaccctaatgtcctgtatgtgtctctc
catcgctacgatgatgggaacttcttccctggcagcggagcccatgatgaggtgggcatc
gggccaggcatgggctttaacgtgaacatggccttcaccggaggtctggagccgcccatg
ggagacgcagactatctggcagcattcaggacggtggtgatgccaattgcgaacgagttc
gctccagacgtggtgctggtttcttcaggcttcgacgctgtggaggggcatctgccacct
ctgggaggatacaagctcacggccaaatgtttcggctacctgaccaagcagctgatggga
ctggccggcggccggctggtgctcgcgctggaggggggtcacgacctcaccgctatttgc
gatgcctctgaagcatgtgtttctgctttgcttggaaacgagttggaccctcttcctgaa
gacgtgctacaacagaggccgaaccccaatgccattcactccatggagaaagttctggaa
gtccacagtaaatactggcgctcgctgcagagatctgcctcgactctgggatactcactg
ctggaggctcagagatgtgaaactgaagaggcagagacggtgaccgccatggcctccctg
tctgtggccaacaagcacatgggaaagaggacagaggaggagcctatggaagaggaacct
ccattgtag

DBGET integrated database retrieval system