KEGG   Sinocyclocheilus grahami: 107601573Help
Entry
107601573         CDS       T04918                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107601573
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107601573
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107601573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 107601573
NCBI-ProteinID: XP_016149296
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MLCRVGYVRRCAATLNPILGAVASRQKHTLPDLPYDYGALEPHICAEIMQLHHSKHHATY
VNNLNVAEEKYQEALAKGDVTTQVSLQPAMKFNGGGHINHTIFWTNLSPNGGGEPQGELL
EAIKRDFGSFQKMKDKISAATVAVQGSGWGWLGFDKDSARLRIAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYVKAIWNVVNWENVSERLQAAKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcagggtcggatatgtccgcaggtgtgctgccaccttgaaccccatcttgggt
gctgtggcctccagacagaagcacacactgcctgacctaccatatgactatggtgcactt
gagcctcacatctgtgctgagattatgcagcttcaccacagcaagcaccatgcaacatat
gtcaacaacctcaatgtcgctgaggagaaatatcaagaggcactggccaagggtgatgtg
acaactcaagtctcccttcagcctgctatgaaatttaacggtggtggccatattaatcat
accatattctggacaaatctgtcaccaaatggtggaggagaaccacagggtgagctgttg
gaagccattaagcgtgactttggctcatttcagaagatgaaggacaagatatcagctgcc
acagtggccgttcagggctcaggatggggctggctgggctttgataaggacagtgcaaga
ctgaggattgctgcttgtgctaaccaagaccctttgcagggcactacaggtctcatccca
ctacttgggatagatgtctgggagcatgcatactatctccagtacaagaatgttagaccg
gactatgttaaggccatctggaatgttgtgaactgggagaatgtcagcgagcgtttacaa
gctgcgaagaaataa

DBGET integrated database retrieval system