KEGG   Sinocyclocheilus grahami: 107601780Help
Entry
107601780         CDS       T04918                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00051  Fructose and mannose metabolism
sgh00052  Galactose metabolism
sgh00500  Starch and sucrose metabolism
sgh00520  Amino sugar and nucleotide sugar metabolism
sgh00524  Neomycin, kanamycin and gentamicin biosynthesis
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
sgh04910  Insulin signaling pathway
Module
sgh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107601780
   00051 Fructose and mannose metabolism
    107601780
   00052 Galactose metabolism
    107601780
   00500 Starch and sucrose metabolism
    107601780
   00520 Amino sugar and nucleotide sugar metabolism
    107601780
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107601780
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107601780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107601780
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107601780
Membrane trafficking [BR:sgh04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107601780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 107601780
NCBI-ProteinID: XP_016149559
LinkDB All DBs
Position
Unknown
AA seq 853 aa AA seqDB search
MGKSSDCFNTEVPKPEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIH
GSGSRLFDHVAECLGDFMEKQKIKDKKLPMGFTFSFPCAHSKLDEAVLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDMVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLTKAKEILTRLG
VEPSEDDCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNSPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPESDVRFLLSESGSGKGAAMVTAWASRLADQTRQIAETLAEFRLT
KEQLLEVKKRMRTEIQNGLSKNTQSTATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGMLVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEIRNIETVDGVDGRMCVNMEWGAFGDNGCLDD
IRTQYDNAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAQICGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRLRQ
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtcttcagactgctttaacacagaggtgcccaaaccagagaagggagatttc
attgcccttgatctgggcggctctaatttccgtattctgcgggtgaaagtgtctcatgag
aagaaacagactgtgcagatggaaagtcagatatatgagactccagaggacatcatccac
ggcagcggatcacggttgtttgaccatgttgcagaatgtcttggagacttcatggagaaa
caaaaaattaaagacaagaagcttcccatgggtttcacgttctcattcccttgtgcacac
tccaaactggatgaggctgttttgctaacatggacaaaacgttttaaggccagtggggtt
gagggaatggatgtagtaaagcttctaaataaagccatcaaaaaacgtggggactatgat
gcagatatcatggctgttgtcaatgacactgtgggaactatgatgacctgtggctttgat
gaccagcgctgtgaagtcggcattattataggaaccggcactaatgcatgttacatggag
gagctaagacacattgacatggtggagggagatgaaggcaggatgtgtattaatactgaa
tggggggcttttggagacgacggtacactggaggatatccgaactgagtttgacagggag
attgatcgtgggtccctcaaccccggcaagcagttgtttgagaagatggtcagtgggatg
tatatgggtgagctggtgaggctgatcctggtcaagatggctaaggaaggcctgctgttt
gagggccgcatcaccccagagctgcttacaaaaggaaaatttgaaaccaaacatgtttct
gcaattgaaaagagtaaagaaggacttaccaaagccaaggagattttgacacgcttgggt
gtagagccatctgaagacgactgcattgctgtgcagcatgtttgcgctattgtctctttt
cgctctgcaaatctaattgctgccactctgggtgcaatcctcacacgtctcaaggacaat
aagaacagtccacgcctccgcaccacagtgggcatcgatggttccctgtacaagatgcac
ccacagtatgcccgccggttgcacaaaactgtgcgtcgtctggtgccagagtctgatgtt
cgcttcttgctctctgaaagtggaagtggcaaaggggctgcaatggtaacagcctgggct
tctcggttggccgatcagacacgtcagattgccgagacgctggcagagttccggttgacc
aaagaacaactgctggaggtgaaaaagagaatgagaactgagatccagaatggattgagc
aagaacacccaaagcacagccaccgtcaagatgctgcccacttatgtgcggagcacccca
gatggaacagaaaatggtgactttttggctctggatcttggaggtacaaacttcagggtg
cttttggtaaagattcgcagtggcaagaaacgaactgtggagatgcataataaaatctac
gctattcccattgaagtaatgcaaggaaccggagaagagctatttgatcacattgtgtac
tgcatatctgacttcctggactatatggggatgaagaatgcccgcctgcctttgggcttt
accttttccttcccttgcagacaaactagtctggatgcgggaatgctggtaacttggaca
aagggctttaaagccacagactgtgaaggagaagatgttgtcggcctcctgagagaggct
atcaagaggagagaggagtttgatttggatgttgtagccatagtgaatgacacagtgggt
acaatgatgacctgcgcatatgaggaacccacatgtgaggttgggctaattgcaggaaca
ggtagtaatgcctgctacatggaggaaatacgaaacattgagacagtcgatggagtggac
ggcaggatgtgtgtgaacatggagtggggagcatttggagataatggctgcctggatgac
atcaggactcagtatgataatgctgtggatgatctctccctcaatgccggcaaacaaaag
tatgagaagatgtgcagtggcatgtacctgggtgagattgtacggaacatcctgattgac
ttgacaaagcgtggcttcctcttcagaggacagatctctgagaccctgaagaccaggggt
atctttgaaaccaagttcctttcccaaatcgagagtgaccgtttggcgctactgcaggtc
aggtccattctgcagcacctgggcctggacagcacatgcgacgacagtattatcgtcaag
gaagtgtgtggagctgtttcccgccgggctgcccagatctgtggagcaggaatggccgct
gttgtagacaaaatccgagaaaaccgtggtctggaccatctggatatcaccgttggggtg
gatggcactctgtataagctccatccacatttctcacggataatgcatcagactgtgaag
gagctcgcccccaaatgcaacgtcaacttcctgctctcagaagacggaagtgggaaaggt
gccgccttgatcaccgccgttgggtgccgcctgcgccagtaa

DBGET integrated database retrieval system