KEGG   Sinocyclocheilus grahami: 107601879
Entry
107601879         CDS       T04918                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00480  Glutathione metabolism
sgh00980  Metabolism of xenobiotics by cytochrome P450
sgh00982  Drug metabolism - cytochrome P450
sgh00983  Drug metabolism - other enzymes
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107601879
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107601879
   00982 Drug metabolism - cytochrome P450
    107601879
   00983 Drug metabolism - other enzymes
    107601879
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgh02000]
    107601879
Enzymes [BR:sgh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107601879
Transporters [BR:sgh02000]
 Other transporters
  Pores ion channels [TC:1]
   107601879
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 107601879
NCBI-ProteinID: XP_016149706
UniProt: A0A672L000
LinkDB
Position
Unknown
AA seq 240 aa
MAPSPKCHGKAGPAPGPVPNGLIRLYSMRFCPFAQRARLVLTAKGVKHEIININLKDKPD
WFLEKNPSGTVPVLETSSGQVIYESPITCEYLDEAYPEKKLLPSDPLERAQQRMLLDHYS
KVIPYFYKISMGKKRGEDVSAAEVEFTEKVSQLHEYLAKKKTKYFGGDSITMIDYLIWPW
FERAEMMGVKHCLANTPELRKWIECMFEDPVVKATMFNTEDHKVFFNTYMDGNPNYDHGL
NT seq 723 nt   +upstreamnt  +downstreamnt
atggctccatctccaaaatgccacggaaaagcaggtcctgctcccggaccagtgccgaat
ggtcttattcgcctctacagcatgagattttgtccgtttgctcagagagcaagactggtg
ctcactgccaagggagttaaacatgaaattatcaacatcaatttgaaggataagcctgat
tggtttctggagaagaatccttcagggacagtgccagtattggaaacctcaagtggtcag
gtgatctacgagtcaccaatcacctgcgagtacttggatgaggcctaccctgagaagaaa
ctgctcccatctgacccgcttgagagggcccaacagagaatgctgctggatcattattca
aaggtgattccatacttctataagatctctatgggcaagaaaagaggagaggatgtctca
gcagctgaagtagaatttacagaaaaagtctcccaactacatgagtatctggcgaaaaag
aagaccaaatattttgggggcgattcaatcacaatgattgactacttgatctggccatgg
tttgagagggcagagatgatgggcgtaaagcattgtttggccaacacccctgagttaagg
aagtggattgaatgcatgttcgaggatccagtggtcaaagccaccatgttcaacacagag
gatcacaaagtgttcttcaacacctacatggacggaaaccctaattatgatcatggttta
tag

DBGET integrated database retrieval system