KEGG   Sinocyclocheilus grahami: 107603182Help
Entry
107603182         CDS       T04918                                 

Definition
(RefSeq) acetyl-CoA carboxylase 1-like isoform X1
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00061  Fatty acid biosynthesis
sgh00620  Pyruvate metabolism
sgh00640  Propanoate metabolism
sgh01100  Metabolic pathways
sgh01212  Fatty acid metabolism
sgh04910  Insulin signaling pathway
Module
sgh_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107603182
   00640 Propanoate metabolism
    107603182
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107603182
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    107603182
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107603182
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     107603182
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     107603182
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     107603182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3 Leuk-A4-hydro_C MetallophosN
Motif
Other DBs
NCBI-GeneID: 107603182
NCBI-ProteinID: XP_016151383
LinkDB All DBs
Position
Unknown
AA seq 1409 aa AA seqDB search
MTEQDATEKKPPAVAVLHSHFIVGSVSEENSEDETAGKLDLQMEENSRSLSPSSVSSDST
YEMGFDSLDGPLHNMRPSMSGLHLVKQGRDRRRIDLQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGTGLTVEWTENDQKKGIINVPTELYEQGCVHDVEAGLKA
AEEIGYPVMVKASEGGGGKGIRKVNGAEDFPNLFRQVQTEVPGSPIFVMQLAKHARHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSDVFEDMEKCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPTAQLQIAMGIPLHRIKDIRVMY
GMQPWGDSPFDFDGLSTTPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQHNSIDTGWLDRLISEKMQAERPDTMLGVVSGALHVADVNLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGTKYVLKVTRQSPNSYVVIMNISLAEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRIIIGNKTCVFEKENDPSLLRSPSAGKLIQYTVEDGGHMFAGQCYA
EIEVMKMVMTLTASESGCIHYVKRAGAVLEPGCVIGKLQLDDPSRVQQAELFTGTLPSVQ
CVALRGEKLHRVFHSTLDHLVHIMNGYCLPEPFFSAKLKEWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPAVEKAIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQKYRSGIRGHMKAVVMDLLRQYLRVEVQFQHGHYDKCVFALREENKGD
MANVLNYIFSHAQVTKKNSLVTMLIDQLCGRDPTLTDELMAILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCIVEFQFMLPTSHPNRGNIPTLNRK
LSAPLQDYKPPDITADASDSAESEDRMSFSSNLNHYGMIHMASVSDVLLDTSFTPPCQRM
GAMVSFRSFQEFTRNIKEVLSCFSDSPPSTPTFPEGGNPVLYGEEDNKSIQDEPIHILNM
AIKTDSDIDDDGLAAMFREFTQSKKSLLFEHGIRRLTFLVAQKDFRKQVNCEVDQRFHVS
SCGMFETLALFHNLSRCLTVYTRNRQLLS
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaggacgctaccgagaagaagcctccagctgtggctgtgctgcactctcac
ttcatcgtgggctctgtatccgaggaaaactctgaagacgaaaccgcagggaagctggac
ctgcagatggaggagaattcgcgctccctttccccctcttctgtcagttcagacagcact
tatgagatgggcttcgacagcctggatggacccttgcacaatatgaggcctagtatgtca
ggacttcacctcgtgaagcagggcagggaccgcagacgcattgacctgcagagggacttt
actgttgcttcccccgctgagtttgtcacccgctttggtggcaacaaagtcattgagaag
gtgctcattgccaacaatggcattgctgcagtcaagtgcatgcgttccatccgtcgctgg
gcttatgaaatgtttcggaatgaacgggccatacgttttgtcgtcatggttaccccggag
gacctcaaggccaatgcagagtacatcaagatggcagatcactatgtacctgtcccagga
gggacaaacaacaacaactatgctaatgtggaactcattttggacatagcaaaacgaatt
cccgttcaggccgtatgggccggttggggtcatgcttctgagaaccccaaactccctgaa
ttgctgcacaagaatggcatcgccttcatgggtccacctagtcaggctatgtgggctctt
ggggataagattgcctcttctattgtggcccagacagctggcatccctacgctaccctgg
agtggaacagggctgactgtagaatggacagagaatgaccagaagaaaggaattattaat
gtccctactgagctgtacgagcagggctgtgtacatgacgtggaggctggacttaaggcg
gcagaagaaataggctaccctgtgatggtgaaggcgtctgaaggcggaggaggaaaaggt
atccggaaagtcaatggtgcagaagacttccctaacctctttagacaggttcaaactgag
gttccaggttcccccatctttgtcatgcaattggccaaacacgctcgccacctggaggtg
cagatcctggctgatcagtacggtaacgccatctctctgtttggccgtgactgctccgtc
caacggaggcatcagaagatcattgaagaagctccggctactattgccacctctgatgtg
tttgaggatatggagaagtgtgcagtgaagctggcgaagatggtgggctatgtgagtgca
ggtacagtggagtatctctacagtcaagacggcagcttttacttcctagagctcaaccct
cgtcttcaagtggaacatccttgtactgagatggtggctgatgttaatctgcctacggcc
caactgcagatcgctatgggcatcccacttcaccgcattaaagacatcagggtgatgtac
gggatgcagccatggggagactccccttttgactttgacggcctctccaccaccccctct
ccacgaggacatgtcattgcagctcgaattactagcgagaacccagatgaggggtttaag
cccagctcaggaactgtccaggaattaaatttccgcagtaacaagaatgtgtggggctac
ttcagcgtggcggctgctggaggtctgcatgagtttgcagactctcagtttggccattgc
ttctcctggggagagaaccgtgaggaggccatctcaaacatggtggtggccctcaaagag
ctgtctatcagaggagacttcaggactacagtggagtatctcataaagctgctagaaaca
gaaagtttccagcacaacagcatcgacacgggttggctggacagactcatctctgagaag
atgcaggccgagcgtcctgacactatgctgggagtagtgagtggagctctgcatgtggct
gatgtcaacctcaggaacagtgtgtccaacttcctgcactcactggagagagggcaggtt
ttacctgcacacaccctgttgaacacagtggatgttgagctgatctacgagggcaccaaa
tatgttctaaaggtgaccagacagtctcctaactcttatgtggtcatcatgaatatctct
ttggcagaggtggatgttcatcgcttgagcgatgggggtctgctgctctcgtatgacggc
agcagctacaccacctatatgaaggaggaggtggacaggtatcgcatcattattggtaac
aagacgtgtgtgtttgaaaaagagaatgatccttcactcctgcgctcgccatctgctggg
aaactcatccagtatactgtggaggatggtggacacatgtttgctggacagtgttatgca
gaaatagaggtgatgaagatggtgatgaccctcaccgcctcggagtctggctgtattcac
tacgtgaagagagcaggtgcagtgcttgagccgggctgtgtcatcggcaaactgcagctg
gacgaccccagcagagtacagcaggcggagctgtttacaggaacattacccagtgttcag
tgtgtggctctcaggggagagaagcttcacagggtcttccacagcactctggatcaccta
gtgcacattatgaacggctactgtctgccagagcccttcttcagtgctaagctgaaagaa
tgggtggagcgtctgatgaagactctgagggacccctctctgcccctgctggagcttcag
gacatcatgacgagcgtttcaggccgtatccctcctgctgtagagaaggctatcaagaaa
gaaatggctcagtacgccagcaacatcacctctgtcctctgccagtttcccagccagcag
attgccaatatactggacagtcatgctgccacgctgaacaggaagtcagagagagaagtc
ttcttcatgaacacacagagcattgtacagctggttcagaagtaccgcagtggcatcaga
gggcatatgaaggcagtggtgatggacctcctcaggcagtatttaagagtggaagttcag
tttcagcatggtcactatgacaagtgtgtatttgcactacgagaggaaaacaaaggggac
atggccaatgtgctcaactacatattctctcatgcacaagtcacaaagaagaactctctg
gtcaccatgttgattgatcagctgtgtggacgagatcccactctgacagatgagctcatg
gcaatactcacagaactcacacagctcagcaagaccactaatgccaaggtggcactgcgg
gcacggcaggttctcattgcctcgcaccttccatcatacgagctacggcacaatcaagtg
gaatccatcttcctgtctgccatcgacatgtacggacatcagttctgcattgaaaacctg
cagaaactgatcctgtcagagacatccatctttgacgtgctaccaaatttcttttaccac
agtaatcaggtggtacggatggctgctctagaggtgtatgttcgtagagcttacatcgct
tatgaactcaacagcgtccagcaccgtcagctgaaggacaacacctgcatcgtggagttc
cagttcatgctgcccacatctcaccctaacagagggaacatccccactctaaacaggaaa
ctgtctgccccactacaggactacaaacctccagatatcacagctgatgctagtgactct
gctgagagtgaggacagaatgtccttttcctctaacttgaaccactatggcatgatccac
atggccagtgttagtgatgtgctcctagacacctccttcaccccaccctgtcagcgcatg
ggcgccatggtttccttccgctccttccaggagttcaccaggaacattaaggaagtgttg
agctgtttctctgactcacccccctctactccaacctttcctgaagggggcaaccctgtg
ctgtatggagaggaggacaacaagagcattcaagatgagccaattcatatccttaatatg
gccataaagacggacagcgacattgatgacgatggactggcggccatgttccgcgagttt
acccagtctaagaaatctctgctgtttgagcatggcatccgaagacttaccttcctggtt
gctcagaaggatttcaggaagcaagtcaactgtgaggtggaccagaggttccatgtaagt
agttgtggaatgtttgagacattggctctgttccacaacctgtcgaggtgcctcactgtc
tacactcgaaataggcagctactttcttag

DBGET integrated database retrieval system