KEGG   Sphingopyxis granuli: SGRAN_0248Help
Entry
SGRAN_0248        CDS       T04372                                 

Definition
(GenBank) ABC transporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sgi  Sphingopyxis granuli
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgi02000]
    SGRAN_0248
Transporters [BR:sgi02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    SGRAN_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SbcCD_C AAA_24 AAA_16 AAA_22 AAA_23
Motif
Other DBs
NCBI-ProteinID: AMG72645
UniProt: A0A0X8QZS3
LinkDB All DBs
Position
271231..272187
Genome map
AA seq 318 aa AA seqDB search
MSDCSVEATGLTKYFGAFKAVDGVDLAVPAGSIYGVLGPNGAGKTTSLRMMLGIIDPDAG
VSRLLGGHTPQSVRHRIGYLPEERGLYPGMKAREAIAFMGALRGLDWSEGRRRAAAFMAE
LGLERVIDEKIRKMSKGMAQMVQLIGSIVHAPDLIVLDEPFSGLDPVNQERLEALVRRER
ERGATILFSTHVMAHAERLCDRIAIIARAQRRFEGSVDDARALLPMQVRYTPRVAAEASA
IRALLPAAAEPHGDAWHFAIGDADVEPLLARITASGFGVTGLSISRPALHDAFVHIVRQV
DAGFHADAEDAAIEEAAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgattgcagcgtcgaggcgaccggcctcaccaaatatttcggcgcgttcaaggcc
gtcgacggagtcgatctcgcggtgccggcgggcagcatctacggcgtgctcggccccaat
ggcgcgggcaagacgaccagcctgcggatgatgctgggcatcatcgatcccgatgccggg
gtcagccggctgctcggcggccacacgccgcaatcggtgcgccaccgcatcggctacctg
cccgaggagcgcgggctctatccgggcatgaaggcgcgcgaagccatcgccttcatgggc
gcgctgcgcgggctcgactggtccgaagggcgccgccgcgccgccgccttcatggccgaa
ctcggcctcgaacgcgtgatcgacgaaaagatccgcaagatgtcgaagggcatggcgcag
atggtccagctcatcggctcgatcgtccatgcgcccgacctgatcgtgctcgacgagcct
ttctccggtctcgacccggtcaaccaggagcgactcgaagcgctggtgcggcgcgagcgg
gagcgcggcgcgacgatcctcttttccacccatgtgatggcgcatgccgagcggctgtgc
gaccggatcgcgatcatcgcgcgcgcgcagcggcgcttcgagggcagcgttgacgatgcg
cgcgcgctgctgccgatgcaggtgcgctacaccccgcgcgtcgcggccgaggcatcggcg
attcgcgcgctgctccccgccgccgccgaaccgcacggcgatgcgtggcattttgcgatc
ggcgatgccgacgtcgaaccgctgctcgcccgcatcaccgcgagcgggttcggggtgacc
ggcctgtcgatcagccgcccggcgctgcacgacgcctttgtccacatcgtccgccaggtc
gatgccggctttcacgccgacgcggaggatgcggcgatcgaggaggccgccgcatga

DBGET integrated database retrieval system