KEGG   Sphingopyxis granuli: SGRAN_1062Help
Entry
SGRAN_1062        CDS       T04372                                 

Gene name
badH
Definition
(GenBank) Aldehyde dehydrogenase
Organism
sgi  Sphingopyxis granuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMG73455
UniProt: A0A0X8R1E2
LinkDB All DBs
Position
1141213..1142676
Genome map
AA seq 487 aa AA seqDB search
MNDRPRIAPVARPDALYIDGAWTRASTGQRIAVADAATATVFMEVAEAGTDDIALAVRAA
REAFDAGPWTQMTHDERAAWLWAIADRLEGRLADLKSLWIAETGITTTHADRVMPSIPDG
FRSYAGLADSFPFSEEHASSVGGRALLLREPVGVVAAIIPWNAPVSMIMHKCAPALLAGC
TIVLKASPEAPGAACIFAEICDEVGLPRGVVNMVTADRQASDALVRDPLVDKISFTGSTE
VGQHIGAVCGSRVARCTLELGGKSAAIVLDDFDIGQAAATIAGGATFLSGQVCAALTRVV
VRRDRHDAMVEALCSAFATVRVADPFDPATGMGPVASERQRARIEQYVEGAVAEGATLAC
GGVRPSNGLDGFFVAPTVFGHVSNAMTIAREEVFGPVLSVIPCADEREAVALANDSLYGL
NAAVFTASADRALDVARQIRAGSVGHNGSRPDFGIAFGGFKRSGIGREGGAEGLRSFLET
KTVVLAP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgatcgcccgcggatcgcccccgtggcgcggcccgacgcgctctatatcgacggg
gcgtggacgcgcgcctcgacgggccagcggatcgcggtcgcggatgcggccaccgcaacg
gtcttcatggaggtggccgaggccggaaccgacgacatcgcgctggccgtgcgggcggcg
cgggaggcgttcgacgcggggccctggacgcagatgactcacgacgagcgggccgcttgg
ctttgggcgatcgcggaccggctggaagggcggctcgccgatctcaagtcgctctggatc
gcggagacgggcatcacgaccacgcacgccgaccgggtcatgccttcgatccccgacggc
tttcgctcctatgccggcctcgccgacagctttcccttcagcgaggaacacgcctcctcc
gtgggcggccgtgccttgctcctgcgcgagcccgtcggcgtcgtcgccgcgatcattccc
tggaacgcgcccgtttcgatgatcatgcacaaatgcgcgccggcgcttctcgccggctgc
acgatcgtcctgaaggcgtcgccggaagcgccgggcgccgcctgcatctttgccgagatc
tgcgacgaggtggggctgccccgcggtgtggtcaacatggtcaccgccgaccggcaggcc
tccgatgccctggtacgcgacccgctggtcgacaagatatcgttcaccggatcgaccgag
gtaggccagcatatcggcgcggtgtgcggttcccgcgtcgcgcgctgcacgctcgaactg
gggggcaagtccgccgcgatcgtcctcgacgatttcgacatagggcaggcggccgccacg
attgccggcggcgccaccttcctttccggccaggtgtgcgccgcgctgacgcgggtggtc
gtccgccgcgaccggcacgatgccatggtggaggcgctctgttcggctttcgcaaccgtc
cgggtcgccgatcccttcgatcctgcgacgggcatggggccggtggcgagcgagcggcag
cgcgcgcggatcgagcaatatgtcgaaggggcggttgcggagggcgcgacgcttgcgtgc
ggcggcgtgcgtccctccaacggcctggacggctttttcgtggcgccgacggtgttcggc
catgtatcgaacgccatgacgatcgcgcgcgaggaggtgttcgggccggtgctttcggtc
attccctgcgccgacgaacgcgaggccgtcgcgctcgcgaacgacagcctgtacgggctg
aacgccgccgtgttcaccgcttccgccgaccgcgccctcgacgtggcccggcagattcgc
gccggcagcgtcgggcataacggttcgcggcccgatttcggcatcgcattcggcggcttc
aagcgatcgggaatcggccgcgaaggcggcgcggagggcctgcggtcgttcctcgaaacg
aagacggtcgttctggcgccctga

DBGET integrated database retrieval system