KEGG   Sphingopyxis granuli: SGRAN_3294Help
Entry
SGRAN_3294        CDS       T04372                                 

Gene name
gabT
Definition
(GenBank) GABA aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00250  Alanine, aspartate and glutamate metabolism
sgi00280  Valine, leucine and isoleucine degradation
sgi00410  beta-Alanine metabolism
sgi00640  Propanoate metabolism
sgi00650  Butanoate metabolism
sgi01100  Metabolic pathways
sgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SGRAN_3294 (gabT)
   00650 Butanoate metabolism
    SGRAN_3294 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGRAN_3294 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SGRAN_3294 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGRAN_3294 (gabT)
Enzymes [BR:sgi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SGRAN_3294 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SGRAN_3294 (gabT)
Amino acid related enzymes [BR:sgi01007]
 Aminotransferase (transaminase)
  Class III
   SGRAN_3294 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMG75637
UniProt: A0A109YMR5
LinkDB All DBs
Position
complement(3606510..3607790)
Genome map
AA seq 426 aa AA seqDB search
MSQNALLLSRRAAAVPQGVATATPLFAERAENAELWDADGTRYIDFAGGIAVLNVGHCHP
RVIAAVRDQLDRYTHTAFQVVAYEPYVALCERLNALAPIAGPAKTVLFTTGAEAVENAVK
IARAATGRPGVIAFGGGFHGRTLLTMAMTGKVLPYKRSFGPLPGEVFHLPFPIAHYGVGV
EDSLRALSLLFAADIEPSRVAAIIVEPVQGEGGFHMAPPELLQALRRICDEHGILLIADE
VQTGFARTGRMFGIEHGGIEPDLMTVAKSLAGGFPLSGVIGRADIMDAAQPGGLGGTYAG
SPVACAAALAVLDVIEEEGLIARANAIGDRLRTTLEAFAARNDLLPIGHVRGPGAMVAFD
LLAARGGDEPDGAAAKRVTARALERGLVLLSCGIHGETIRLLMPLTASDAVVDEGMAILE
EALSAL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaatgcccttcttttgtcgcgccgtgccgccgccgttccgcagggggtcgcc
accgcgacgccgctgttcgcggagcgcgccgaaaatgccgagctgtgggatgccgacggc
acgcgctacatcgactttgccggcggcatcgcggtgctcaacgtcgggcattgccatccg
cgggtgatcgcggcggtgcgcgaccaactcgaccgctacactcacacggcgtttcaggtc
gtcgcctatgaaccctatgtcgcgctgtgcgagcggctgaacgcgctcgcgcccatcgcg
gggcccgccaagacggtcctgttcacgaccggggccgaagcggtcgagaatgcggtgaag
atcgcgcgcgccgcgaccgggcggccgggcgtgatcgccttcggcgggggctttcacggc
cgcacgctgctcaccatggcgatgacgggcaaggtgctgccctacaagcgcagctttggt
ccgttgccgggcgaggtattccacctgccgttcccgatcgcccactatggcgtcggcgtc
gaggacagcctgcgtgccctgtcgctgctgttcgccgccgacatcgagccgtcgcgcgtc
gccgcgatcatcgtcgagccagtgcagggcgagggcggcttccacatggcgccgcccgaa
ttgctccaggcgctgcgccgtatctgcgacgagcatggcatcctgctgatcgccgacgag
gtgcagaccggcttcgcgcgcaccgggcggatgttcgggatcgagcatggcgggatcgag
cccgacctgatgaccgtcgccaagtcgctcgccggcggcttcccgctgtcgggggtgatc
ggccgcgccgacatcatggacgcggcgcagcccggcggactcggcggcacctatgcgggg
tcgcccgtcgcctgcgcggcggcgctcgcggtgctcgacgtgatcgaggaggaggggctg
atcgcgcgggcgaacgccatcggcgatcgattgcggaccacgctggaagccttcgcggcg
cgcaatgaccttctgcccatcggtcatgtccgcggccccggcgcgatggtcgcgttcgac
ctgctcgcggcgcgcggcggcgacgagcccgacggcgcggcggcgaagcgcgtgacggcg
cgcgccctggagcgggggcttgtgctgctgagctgcggtatccacggcgaaaccatccgc
ctgctgatgccgctcaccgcgtccgacgcggtggtcgacgagggcatggcgatactggaa
gaggcattgagcgcattatga

DBGET integrated database retrieval system