KEGG   Sphingopyxis granuli: SGRAN_3986Help
Entry
SGRAN_3986        CDS       T04372                                 

Gene name
gst5
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SGRAN_3986 (gst5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgi02000]
    SGRAN_3986 (gst5)
Enzymes [BR:sgi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SGRAN_3986 (gst5)
Transporters [BR:sgi02000]
 Other Transporters
  Pores ion channels [TC:1]
   SGRAN_3986 (gst5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AMG76315
UniProt: A0A0X8R714
LinkDB All DBs
Position
4385763..4386398
Genome map
AA seq 211 aa AA seqDB search
MAAELIFYTNPMSRGQIVRWMLEEVGAPHETRLLDYGTTMKGADYLAINPMGKVPAIVHA
GRTVTECAAICAYLADAFPDAGLAPAPVDRADYYRWLFFAAGPLEQAITAKQFGFEPEAD
QQRMAGFGSLASVLEALEGAVAGKAFVAGDRFSAADVYVGSQIDWGLQFGTIPSRPAFEA
YIAPLRERTGYKRAKEIDNALIADMQAAGPA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgaactgatcttctacaccaaccccatgtcgcgcgggcagatcgtccgatgg
atgctcgaagaggtcggcgcgccccatgaaacgcggctgctcgactatgggacgacgatg
aagggcgccgattatctggcgatcaatccgatgggcaaggttccggcgatcgtccatgcc
ggcaggaccgtcaccgaatgcgcggcgatctgtgcctatctggccgacgccttcccggac
gcgggcctcgcgcccgcgccggtcgatcgcgccgattattaccgctggctcttcttcgcc
gccgggccgctcgaacaggcgatcaccgcaaagcagttcgggttcgaacccgaggccgat
cagcaacggatggcgggtttcggctcgctcgcatccgtgctcgaagcgctggaaggcgcg
gtcgcgggcaaggccttcgtcgccggcgaccgcttcagcgccgccgatgtctatgtcggc
agccagatcgactggggcctgcaattcggcaccatcccatcgcgcccggcgttcgaagcc
tatatcgcgcctctgcgcgagcgcacgggctacaagcgcgcgaaggagatcgacaatgcg
ctgatcgcggacatgcaggcggcggggccggcctga

DBGET integrated database retrieval system