KEGG   Sphingopyxis granuli: SGRAN_4058Help
Entry
SGRAN_4058        CDS       T04372                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00620  Pyruvate metabolism
sgi00680  Methane metabolism
sgi01100  Metabolic pathways
sgi01120  Microbial metabolism in diverse environments
sgi01200  Carbon metabolism
Module
sgi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGRAN_4058 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SGRAN_4058 (ppc)
Enzymes [BR:sgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGRAN_4058 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AMG76385
UniProt: A0A109YN99
LinkDB All DBs
Position
4464262..4466931
Genome map
AA seq 889 aa AA seqDB search
MNQPIQISQNPDIRYLGRILGEVIRAQGGETLFRRTEYIRSASVDRHRGIAGAEAIDPGL
DALSLDDTIAFVRGFMLFSMLANLAEDRQGVAAEPGATVAAALERLAAEGIDGDAVTALL
ERALVAPVLTAHPTEVRRKSVLDHKNRIAELMRLRDAGREETPEGDSVEAAIRRQIALLW
QTRPLRTERLFVADEIDNALTYLRDVFLPVVPRLYARWEKELGRRPASFLRVGSWIGGDR
DGNPFVTAETLETATGRNAAAVLSHYCDAVHALGTELSVSQTLAPVPETVTALADASGDE
APSRSDEPYRRALSGIYARLCATHVAIVGHPPPRPSMLAGEPYAAPADFRRDLVTLADGL
SAGGEGQLGGLGALGRLIRAVEVFGFHLATLDMRQNSAVHERVLAELLRVSGVEGDYLAL
DEEARVALLRRELAVDRPLAAPWHRWSEETAGELAIVHAAAAIRARLGREAICQWIISKA
ESLSDLLEVHVLAREAGLWSGDADDALMVVPLFETIADLDQAPAIMAAYFALPEIAQRVG
ARGSQEVMIGYSDSNKDGGYLTSTWGLHQASAALTPVFAAADTAMQLFHGRGGAVGRGGG
SAFAAIRAQPAGTVQGRIRITEQGEVIAAKYGTTDSAATNLEAMVSASLLASLEPEAKSA
ADAVRFAGAMDALSDHAFAAYRGLVYDTPGFRDVFRAMTPIAEIATLKIGSRPSSRTKSS
AIEDLRAIPWVFSWAQARTMLPGWYGTGEAFAAFPDQTLLAEMAAGWPFFAALLDNMEMV
LAKSDMGIAARYAGLASHIDGHDAIFMAIRDGWQRAHDGLLRITGQSRLLEKNPALEASI
RLRLPYIEPLNLLQIELMKRHRAGETDPRIAEGIQLTINAIATALRNSG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccgatccagatcagccagaatcccgacatccgctatctcgggcggatattg
ggcgaggtcattcgcgcgcagggcggcgagacgctgttccgccggaccgaatatatccgt
tcggcgagcgtcgaccggcatcgcggtatcgcgggggccgaggcgatcgacccggggctc
gacgcgctgagtctcgacgacacaatcgccttcgtgcgcggcttcatgctcttttcgatg
ctcgccaacctggcggaggaccggcagggcgtcgccgccgagcccggggcgacggtggcg
gcggcgctcgagcggctggcggcggagggaatcgacggcgatgcggtgacggcactgctg
gagcgggcgctggtcgccccggtgctgaccgcccacccgaccgaggtgcgccgcaagtcg
gtactcgaccacaagaaccgcatcgccgaactgatgcggctgcgcgacgcggggcgcgag
gaaacgcccgagggcgacagcgtcgaagcggcgatccgccgccagatcgcgctgctgtgg
cagacgcggccgctgcgcaccgaacgcttgttcgtcgccgacgagatcgacaatgcgctc
acctatctgcgcgacgtctttctgccggtcgtgccgcggctctatgcgcgctgggaaaag
gagttggggcggcgccccgcgagcttcctgcgcgtcggaagctggatcggcggcgaccgc
gacggcaatcccttcgtcaccgccgaaacgctggagacggcgaccggacgcaacgcggcg
gcggtgctcagccattattgcgacgcggtgcatgcactcggcaccgagctgtcggtatcg
cagacgctggccccggtgcccgaaacggtcacggcactcgccgatgcgagcggcgacgaa
gcgccgagccgcagcgacgaaccctatcgccgcgcgctgtcgggcatctatgcgcggctg
tgcgccacccatgtcgcgatcgtcggccacccgccgccgcgcccgtcgatgctggcgggc
gagccctatgccgcgcccgccgatttccgccgcgacctcgtcaccctcgccgacgggctg
tctgcggggggcgaggggcagctcggcgggctcggcgcgctggggcggctgatccgcgcg
gtcgaagtcttcggcttccacctcgcgacgctcgacatgcgccagaacagcgcggtgcac
gaacgcgtgctcgccgaactgctgcgcgtctcgggggtcgagggcgattatctggcgctg
gacgaggaggcgcgcgtcgcgctgctgcgccgcgaactggcggtcgatcggccgctcgcc
gcgccatggcaccggtggagcgaggaaacggcgggcgaactggcgatcgtccacgccgcc
gccgcgatccgcgcgcggctggggcgcgaggcgatctgccagtggatcatcagcaaggcc
gaaagcctgtccgacctgctggaggtccatgtcctcgcgcgcgaggcggggctgtggtcg
ggcgatgccgacgatgcgctgatggtcgtgccgctgttcgagacgatcgccgacctcgat
caggcgcccgcgatcatggccgcctatttcgcgctgcccgagatcgcgcagcgcgtcggc
gcgcgcgggtcgcaggaagtgatgatcggctattccgattcgaacaaggacggcggctat
ctgacctcgacctggggactgcatcaggcatcggcggcgctgaccccggtgttcgcggcg
gcggacaccgcgatgcagctgttccacggacgcggcggcgcggtcgggcgcggcggcggc
agcgccttcgcggcgatccgcgcccagcccgcgggcacggtgcagggccgcatccgcatc
accgaacagggcgaggtgatcgcggccaaatacggcaccaccgacagcgccgcgaccaat
ctggaggcgatggtgtcggccagcctgctcgccagcctggagcccgaggcgaagagcgcg
gccgatgcggtgcgcttcgcgggcgcgatggatgcgctgtccgatcatgccttcgccgcc
tatcgcgggcttgtctacgacacgccgggctttcgggatgtcttccgcgcgatgacgccg
atcgcggagatcgcgacgctgaagatcgggtcgcgcccgtcgagccggacgaagagcagc
gcgatcgaggacctgcgcgccattccctgggtgttcagctgggcgcaggcgcgcacgatg
ctgcccggatggtacgggacgggcgaggcgttcgccgccttccccgaccagacgctgctc
gccgagatggcggcgggctggcccttcttcgcggcgctgctcgacaatatggagatggtg
ctcgccaagtccgacatggggatcgcggcgcgctatgccgggctcgcgagccatatcgac
gggcatgacgcgatcttcatggcgatacgtgacggctggcagcgcgcgcacgacggcctg
ctgcggatcaccggccagtcgcggctgctggagaagaatccggcgctcgaagcgtcgatc
cggctgcgcctgccctatatcgagccgctcaacctgctccagatcgagctgatgaagcgc
caccgcgcgggcgagaccgacccgcgcatcgccgagggcatccaactgacgatcaacgcg
atcgcgacggcgctgcggaatagcgggtag

DBGET integrated database retrieval system