KEGG   Sphingopyxis granuli: SGRAN_4075Help
Entry
SGRAN_4075        CDS       T04372                                 

Gene name
echA9
Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgi  Sphingopyxis granuli
Pathway
sgi00071  Fatty acid degradation
sgi00280  Valine, leucine and isoleucine degradation
sgi00281  Geraniol degradation
sgi00310  Lysine degradation
sgi00360  Phenylalanine metabolism
sgi00362  Benzoate degradation
sgi00380  Tryptophan metabolism
sgi00410  beta-Alanine metabolism
sgi00627  Aminobenzoate degradation
sgi00640  Propanoate metabolism
sgi00650  Butanoate metabolism
sgi00903  Limonene and pinene degradation
sgi00930  Caprolactam degradation
sgi01100  Metabolic pathways
sgi01110  Biosynthesis of secondary metabolites
sgi01120  Microbial metabolism in diverse environments
sgi01130  Biosynthesis of antibiotics
sgi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGRAN_4075 (echA9)
   00650 Butanoate metabolism
    SGRAN_4075 (echA9)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGRAN_4075 (echA9)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGRAN_4075 (echA9)
   00310 Lysine degradation
    SGRAN_4075 (echA9)
   00360 Phenylalanine metabolism
    SGRAN_4075 (echA9)
   00380 Tryptophan metabolism
    SGRAN_4075 (echA9)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGRAN_4075 (echA9)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGRAN_4075 (echA9)
   00281 Geraniol degradation
    SGRAN_4075 (echA9)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGRAN_4075 (echA9)
   00627 Aminobenzoate degradation
    SGRAN_4075 (echA9)
   00930 Caprolactam degradation
    SGRAN_4075 (echA9)
Enzymes [BR:sgi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGRAN_4075 (echA9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AMG76402
UniProt: A0A109YN85
LinkDB All DBs
Position
complement(4485611..4486657)
Genome map
AA seq 348 aa AA seqDB search
MTEDVLIGVEGRVGRIALNRPKAIHALNLPMCQAMIDALLAWRDDAAIEAVVIDHSEGRG
FCAGGDIRMLAESGAKDGREARAFFHTEYRLNHLLFTYAKPVVAFMDGITMGGGVGISQP
AKYRVATEHTRFAMPETGIGLFPDVGGGWYLPRLEGRVGAFLALTGARLDGAECLALGLA
THYLPSANLAEAKERIAQHPDRIGGILGELSVTAPPAAITGQIDKINRLFASDRYEDILA
ALEKDGGEWAQKELGALRTKSPQTCKVALRQLREGAAMPDFAAEMRQEYAIGSRVVAMHD
FLEGVRALIVDKDNSPKWDPSTPEAVTDEWIDAIFAPLPPGEAWTPLT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagatgtattgatcggtgtcgagggccgcgtcggccgcatcgcgctgaaccgc
ccgaaggcgatccacgcgctcaacctgccgatgtgtcaggcgatgatcgacgcgctgctc
gcctggcgcgacgatgccgcgatcgaggccgtcgtcatcgaccatagcgagggccgcggc
ttctgcgccggcggcgacatccgcatgctcgcggaaagcggggcgaaggacgggcgcgag
gcgcgggccttcttccacaccgaatatcgcctcaaccacctgctcttcacctatgcgaag
cccgtcgtcgccttcatggacggcatcaccatgggcggcggggtcggcatttcgcagccg
gcgaaatatcgcgtcgcgaccgaacatacgcgcttcgcgatgcccgagaccgggatcggc
ctgttccccgacgtcggcggcggctggtatctgccgcggctggaggggcgcgtcggcgcc
ttcctcgcgctcaccggcgcgcggctcgacggggccgaatgcctcgcgctcggcctcgcc
acccattatctgccgtcggcgaatctcgccgaggcgaaggagcgcatcgcgcagcacccc
gaccgcatcggcggcatattgggcgagctgtcggtcaccgctccgcccgccgcgatcacc
ggccagatcgacaagatcaaccggctgttcgccagcgaccgctacgaggatattctcgcc
gcgctggaaaaggacggcggcgaatgggcgcagaaggaattgggcgcgctgcgcaccaag
agcccgcagacctgcaaggtcgcgctgcgccagcttcgcgagggcgcggcgatgcccgat
tttgccgccgagatgcgccaggaatatgcgatcggcagccgcgtcgtcgcaatgcacgac
ttcctcgaaggcgtccgcgcgctgatcgtcgacaaggacaacagcccgaaatgggacccg
tcgacgcccgaagcagtgaccgacgaatggatcgacgcgatcttcgcgcctttgccgccg
ggtgaagcgtggacgccgctaacatag

DBGET integrated database retrieval system