KEGG   Streptomyces genisteinicus: IAG43_11500
Entry
IAG43_11500       CDS       T07903                                 
Name
(GenBank) pentalenene synthase
  KO
K12250  pentalenene synthase [EC:4.2.3.7]
Organism
sgj  Streptomyces genisteinicus
Pathway
sgj00909  Sesquiterpenoid and triterpenoid biosynthesis
sgj00998  Biosynthesis of various antibiotics
sgj01100  Metabolic pathways
sgj01110  Biosynthesis of secondary metabolites
Module
sgj_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sgj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    IAG43_11500
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    IAG43_11500
Enzymes [BR:sgj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.7  pentalenene synthase
     IAG43_11500
SSDB
Motif
Pfam: Terpene_syn_C_2 Terpene_synth_C DUF4844
Other DBs
NCBI-ProteinID: QNP63492
UniProt: A0A7H0HSH6
LinkDB
Position
2635160..2636323
AA seq 387 aa
MANAMDFGHLPSPADPTRRTTAVRIPYPALLNPHAERARRHTLQWLLTTGLLGGEAATSE
YDTLRLERLMAYFYPTANAADLELAADFNAWFFIFDDQFDGGLGMRPRAIERLVESLGRI
MTPDDTVPVASPPLVRAFGDIWRRSTAGRAPHWRRRFRTHWLAYMAAHQGEARNRNADGL
PTPEAFLELRRHSIGVQPCLDFTERCGGYALPDDLHGAEPLREMREVTADVVIFVNDIVS
LVKEIAAGDVNNSVLVLRGHKGCSLDEAVDLTAALANRRIARFGELAAALPAALQARRVP
AEVRGHVDHYVEGMRHVMAGNLAWSLATSRYDERGIAAVSGGRQRPWGALAAQQGGPPVP
APAGPAEPAPPATGPFPTQRGAPHPGR
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcgaacgcgatggacttcggccaccttcccagccccgcggatcccacccggcgcacg
acggcggtcaggatcccttacccggcacttctcaacccgcacgcggaacgcgcccggcgg
cacacgctccagtggctgctgaccaccggactgctcggcggggaggccgcgacgtcggag
tacgacacgctccgcctggagcggctgatggcctacttctacccgacggcgaacgccgcc
gacctcgaactcgccgccgacttcaacgcctggttcttcatcttcgacgaccagttcgac
ggcgggctcgggatgcggccgcgcgcgatagagcgcctggtggagagcctgggacggatc
atgacccccgacgacacggtgccggtggccagtccgccgctggtccgcgccttcggcgac
atctggcggcgctccacggcgggcagggcgccccactggcggcgccgcttccgcacccac
tggctcgcgtacatggcggcgcaccagggcgaggcgcgcaaccggaacgcggacggcctg
ccgacccccgaggccttcctcgaactgcggcgccactccatcggcgtgcagccgtgcctg
gacttcaccgagcggtgcgggggctacgcgctgccggacgacctgcacggggccgaaccg
ctgcgcgagatgcgggaggtgacggccgacgtggtgatcttcgtcaacgacatcgtgtcg
ctggtgaaggagatcgccgcgggcgacgtcaacaacagcgtgctggtgctgcgcggccac
aagggctgctcgctggacgaggccgtcgacctgacggccgcgctcgccaaccggcggatc
gcccgcttcggcgaactcgccgccgccctccccgcggcgctccaggcccggcgcgtgccg
gccgaggtgcgggggcacgtcgaccactacgtcgagggcatgcgccatgtgatggcgggc
aatctggcgtggtcgctggcgacctcgcggtacgacgagcgcggcatcgccgccgtcagc
ggcggccggcagcgtccctggggcgcgctcgccgcgcagcagggcggcccgcccgtcccg
gcccccgccggccccgcggagccggccccgcccgccaccggccccttccccacccagcgc
ggcgccccgcaccccggccggtag

KEGG   Streptomyces genisteinicus: IAG43_27155
Entry
IAG43_27155       CDS       T07903                                 
Name
(GenBank) pentalenene synthase
  KO
K12250  pentalenene synthase [EC:4.2.3.7]
Organism
sgj  Streptomyces genisteinicus
Pathway
sgj00909  Sesquiterpenoid and triterpenoid biosynthesis
sgj00998  Biosynthesis of various antibiotics
sgj01100  Metabolic pathways
sgj01110  Biosynthesis of secondary metabolites
Module
sgj_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sgj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    IAG43_27155
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    IAG43_27155
Enzymes [BR:sgj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.7  pentalenene synthase
     IAG43_27155
SSDB
Motif
Pfam: Terpene_syn_C_2 Terpene_synth_C
Other DBs
NCBI-ProteinID: QNP66248
UniProt: A0A7H0I0D2
LinkDB
Position
6308764..6309777
AA seq 337 aa
MPQDVDFHIPLPGRQSPDHARADAEQLVWPRSLGLIKSEAAAERHLRGGYADLASRFYPH
ATGADLDLGVDLMSWFFLFDDLFDGPRGENPEETRALTDAVAAALDGPLPDTAPPIAHGF
ADIWGRTCEGMTPAWCARSARHWRGYFDGYVDEAESRFRDRPYECAAQYLAVRRQTIGVQ
PTVDLAERAGRFEVPHRVFDSAVVSAMLQIAADVNLLLNDIASLEKEEARGEQNNMVMIL
RREHGWAEDRSVSHIQGEVRARLEQYLLLETCLPRVADIYRLEEAEREALEHYRDDAVRT
VIRGSYDWHRSSGRYDAEFAVAAGAQGYLEELGSTAR
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgccccaggacgtcgacttccacatacccctgccgggccggcagagcccggaccacgcc
cgcgccgacgccgagcagctcgtctggccgcgctcgctcgggctgatcaagtccgaggcg
gccgccgagcgccacctgcgcggcggctacgccgacctggcctcccgcttctacccccac
gccacgggcgccgacctggacctgggcgtcgacctgatgtcctggttcttcctcttcgac
gacctcttcgacgggccgcgcggcgagaacccggaggagacccgagcgctcaccgacgcg
gtcgcggcggcgctggacggccccctccccgacaccgcgccgcccatcgcccacggcttc
gccgacatctgggggcgcacctgcgagggcatgacgcccgcctggtgcgcgcgcagcgcc
cggcactggcgcggctacttcgacggctacgtcgacgaggcggagagccgcttccgggac
cggccgtacgaatgtgccgcccagtacctggccgtgcgccggcagaccatcggggtgcag
ccgacggtcgacctcgccgagcgcgcgggccgcttcgaggtgccgcaccgggtcttcgac
agcgccgtggtctccgcgatgctccagatagcagccgacgtcaatctgctgctcaacgac
atcgcctcgctggagaaggaggaggcccgcggcgagcagaacaacatggtcatgatcctg
cgccgggaacacggctgggccgaggaccgcagcgtctcccacatccagggcgaggtacgg
gcccgcctggagcagtacctcctgctggagacgtgcctgccgcgggtcgccgacatctac
cggctggaagaggccgagcgcgaggccctggagcactaccgcgacgacgccgtgcgcacc
gtgatccgcggttcctacgactggcaccgctcctcgggccgctacgacgccgagttcgcg
gtcgccgccggcgcccagggctatctggaggagctcggcagcaccgcccgctag

DBGET integrated database retrieval system