KEGG   Streptomyces genisteinicus: IAG43_27125
Entry
IAG43_27125       CDS       T07903                                 
Name
(GenBank) phytanoyl-CoA dioxygenase family protein
  KO
K18056  1-deoxypentalenic acid 11beta-hydroxylase [EC:1.14.11.35]
Organism
sgj  Streptomyces genisteinicus
Pathway
sgj00998  Biosynthesis of various antibiotics
sgj01100  Metabolic pathways
sgj01110  Biosynthesis of secondary metabolites
Module
sgj_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sgj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    IAG43_27125
Enzymes [BR:sgj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.35  1-deoxypentalenic acid 11beta-hydroxylase
     IAG43_27125
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-ProteinID: QNP66243
UniProt: A0A7H0I0C7
LinkDB
Position
6301633..6302484
AA seq 283 aa
MTDTFTDYVDCTPLLDDREALDRFYDEHGYVYLRGALDRDLVRTAAEQMLEGLIALGHAA
PGTTLDTLAIDSFEAVDEVAMHDYVRYDDLWNHPSTLKVWEQVFGEPVFVFKSTTIRYYP
SAAGSAEPSFLTPLHQDGFYIGPNKDFRTAWMPLIPTNRGTGGVAVADGSHKKGPREHVV
TENFRRFGHAVRGIPAEEFGADEQLLFSPMEPGDVILFHAFMCHKSIPNVSVDPAGMRMS
MDTRIQPASSPRGFNSLTPWPESARDASKGILSKITGTPTTTE
NT seq 852 nt   +upstreamnt  +downstreamnt
atgacggacactttcaccgactacgtcgactgcacgcctcttctcgacgaccgcgaggct
ctcgaccgcttctacgacgagcacggctacgtctatctgcgcggtgctctggaccgtgac
ctcgtgcggaccgctgccgagcagatgctcgagggcctgatcgcactcggtcacgccgcc
cccggcaccacgctcgacaccctcgccatcgactccttcgaggcggtcgacgaggtggcg
atgcacgactacgtacggtacgacgacctgtggaaccacccctcgaccctcaaggtctgg
gagcaggtcttcggtgagcccgtcttcgtcttcaagtcgacgaccatccgctactacccc
tccgccgcaggctccgcggagccgagcttcctgacgccgctccaccaggacggcttctac
atagggccgaacaaggacttccgcacggcctggatgccgctgatcccgacgaaccgcggc
acgggcggcgtcgcggtcgccgacggcagccacaagaagggcccgcgcgagcacgtcgtc
accgagaacttccgccgcttcggccacgccgtccgcggcatcccggccgaggagttcggc
gcggacgagcagctgctgttctcgcccatggaaccgggcgacgtgatcctcttccacgcc
ttcatgtgccacaagtccatcccgaacgtctcggtggaccccgcgggcatgcggatgtcg
atggacacccgcatccagcccgcctcctcgccccgcgggttcaactccctgaccccctgg
ccggagtccgcgagggacgcctccaagggaatcctgtcgaagatcaccggcacgcccacc
accaccgagtga

DBGET integrated database retrieval system