KEGG   Streptomyces genisteinicus: IAG43_27140
Entry
IAG43_27140       CDS       T07903                                 
Name
(GenBank) NAD(P)/FAD-dependent oxidoreductase
  KO
K18091  pentalenolactone D synthase [EC:1.14.13.170 1.14.13.171]
Organism
sgj  Streptomyces genisteinicus
Pathway
sgj00998  Biosynthesis of various antibiotics
sgj01100  Metabolic pathways
sgj01110  Biosynthesis of secondary metabolites
Module
sgj_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sgj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    IAG43_27140
Enzymes [BR:sgj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.170  pentalenolactone D synthase
     IAG43_27140
    1.14.13.171  neopentalenolactone D synthase
     IAG43_27140
SSDB
Motif
Pfam: FMO-like NAD_binding_8 Pyr_redox_2 Pyr_redox_3 NAD_binding_9 DAO FAD_binding_2 Shikimate_DH Thi4
Other DBs
NCBI-ProteinID: QNP67614
UniProt: A0A7H0I498
LinkDB
Position
6304941..6306695
AA seq 584 aa
MREKYRQERDKRSAGRTYQFARGDFSRFARDPYTERQEREPLTDEVDVAVVGAGIGGLLT
GAHLRKETGLERIRLIDEAGDVGGTWYWNRFPGVRCDVESYIYMPLLEEIGTIPTEKYST
GPEIFAHLQKIAHRYDLYRDALFQTAVTELRWDEAAGNWLVSTDRGDLIRARYVAMSIGL
MHRPKLPGLPGLETFAGHSFHTSRWDFDYTGGDSTGGLTGLKDKTVGVIGTGSTTIQLAP
HLAEWAERLVLFQRTPAAVDVRGNRPTPSDWAAGLEEGWQQRRMENFHALTSGVPQDEDL
VQDRWTQTTAKLAAAILPTGDDGGDPKERALAAERADFLKMEELRARIDSVVTDPATAAA
LKPYYRVYCKRPCFHDGYLQTFNRPNVTLVDTQGQGVERLTPAGVVANGREYPVDCLIFA
TGYEHEFAVPYTDRAGYDIVGRDGVRLSQKWADGAHTLHGLQVNGFPNCFILSKVQAGRH
VNIAYMLGEQTRHLAYVVKSVEERGHRVVEASEAGEKEWVAEILRLAAGGLDFLENCTPG
LYNNEGNPSGLPLLNSSYGGGSVEFVNILRRWREAGDLAGLELH
NT seq 1755 nt   +upstreamnt  +downstreamnt
gtgcgggagaagtaccggcaggaacgcgacaagcgcagcgccggccgcacctaccagttc
gcgcgcggtgacttcagccgcttcgcgcgcgacccctacaccgaacgccaggagcgcgag
ccgctcaccgacgaggtggacgtcgccgtggtcggcgccggcatcggcggcctgctgacc
ggcgcgcatctgcgcaaggagaccggcctggagcgcatccggctgatcgacgaggcgggc
gacgtcggcggcacctggtactggaaccgcttcccgggcgtccgctgcgacgtcgagagc
tacatctacatgccgctgctcgaggagatcggcacgatacccaccgagaagtactccacc
gggcccgagatcttcgcccacctccagaagatcgcccaccggtacgacctctaccgcgac
gccctgttccagaccgccgtcaccgaactgcgctgggacgaggccgccgggaactggctg
gtgagcaccgaccgcggcgatctgatccgggcccggtacgtggccatgtcgatcggtctg
atgcaccgccccaaactccccgggctgccgggcctggagacgttcgccgggcactccttc
cacaccagccgctgggacttcgactacaccggcggcgacagcaccggcggcctgaccggg
ctgaaggacaagacggtcggcgtcatcggcaccggctccacgaccatccagctcgccccg
cacctcgccgagtgggccgagcggctcgtcctcttccagcgcaccccggccgcggtcgac
gtccgcgggaaccggcccaccccgtccgactgggcggccggcctcgaagagggctggcag
cagcgccggatggagaacttccacgcgctgacctccggtgtcccgcaggacgaggacctg
gtccaggaccgctggacccagaccacggccaagctggccgccgcgatcctgcccaccggc
gacgacggcggcgatccgaaggagcgggcactcgcggccgagcgggccgacttcctcaag
atggaggaactgcgcgcccgcatcgacagcgttgtcaccgaccccgcgaccgccgccgca
ctcaagccgtactaccgcgtgtactgcaagcggccctgcttccacgacggctacctccag
accttcaaccggcccaacgtgaccctggtcgacacccaggggcagggcgtggagcggctc
accccggccggggtggtcgcgaacggccgggagtacccggtcgactgcctgatcttcgcc
accggctacgagcacgagttcgccgtcccgtacaccgaccgcgccggctacgacatcgtc
ggccgcgacggcgtgaggctgtctcagaagtgggcggacggggcgcacaccctgcacgga
ctccaggtgaacggcttccccaactgcttcatcctgtccaaggtccaggccggccggcac
gtcaacatcgcctacatgctgggcgagcagacccggcacctcgcgtacgtcgtcaagtcc
gtcgaggagcgcggccaccgggtcgtggaggcctccgaggccggcgagaaggaatgggtc
gcggagatcctccggctcgccgcgggcggcctcgacttcctggagaactgcacgcccggc
ctctacaacaacgagggcaacccgagcggacttcccctgctcaactccagctacggcggc
ggctcggtggagttcgtgaacatcctcaggcgctggcgcgaggcgggcgacctggccggt
ctcgaactgcactga

DBGET integrated database retrieval system