KEGG   Sodalis glossinidius (Glossina spp.): SG0127Help
Entry
SG0127            CDS       T00316                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sgl03012]
    SG0127
   03029 Mitochondrial biogenesis [BR:sgl03029]
    SG0127
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgl04147]
    SG0127
Translation factors [BR:sgl03012]
 Eukaryotic Type
  Elongation factors
   SG0127
 Prokaryotic Type
   SG0127
Mitochondrial biogenesis [BR:sgl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SG0127
Exosome [BR:sgl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SG0127
  Exosomal proteins of breast cancer cells
   SG0127
  Exosomal proteins of colorectal cancer cells
   SG0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: BAE73402
UniProt: Q2NQL7
LinkDB All DBs
Position
212377..213561
Genome map
AA seq 394 aa AA seqDB search
MSKEKFQRTKPHVNVGTIGHVDHGKTTLTAAITTVLAKAYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDEAWTAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttcaacgcacaaaaccacacgttaacgtcggtactatcggccac
gttgaccatggtaaaacgaccctgaccgccgccatcaccaccgttctggccaaggcctac
ggcggtagcgcgcgcgcgttcgatcagatcgacaacgcgccggaagaaaaggcccgtggt
atcaccatcaacacctcacacgttgaatacgataccccgacccgccactacgcgcacgta
gactgcccgggacacgccgactatgtgaaaaacatgatcaccggcgcggcgcagatggac
ggcgctattctggtggttgccgcgacagacggcccgatgccgcagacccgcgagcacatc
ctgctgggtcgccaggtcggcgtaccgtacatcatcgtgttcatgaacaaatgcgacatg
gtcgatgacgaagagctgctggaactggtagaaatggaagtgcgcgaactgctgtcgcag
tacgacttcccgggcgacgacacgccggttatccgcggctcggcgctgaaagcgctggaa
ggcgatgaagcctggaccgccaagatcatcgaactggcagaagcgctggacagctacatt
ccggaaccggaacgcgccattgacaagccgttcctgctgccgatcgaagacgtgttctcc
atctccggccgcggtaccgtggtcaccggtcgtgtagagcgcggcatcgtcaaagtgggt
gaggaagtggaaatcgtcggcatcaaagacaccaccaaaaccacctgcaccggcgttgaa
atgttccgtaaactgctggacgaaggccgtgccggcgagaacgttggcgttctgctgcgc
ggtaccaagcgtgacgacgtagagcgtggtcaggttctggccaagccgggctcgatcaag
ccgcacacccagtttgaatcagaagtttatattctgagcaaagacgaaggcggccgccac
acgccgttctttaaaggctaccgcccgcagttctacttccgtacgactgacgtgaccggt
accatcgaactgccggaaggcgttgaaatggtcatgcctggcgacaacatcaagatggtt
gttaatctgattgccccgatcgccatggacgacggcctgcgtttcgctatccgcgaaggc
ggccgtaccgttggcgccggcgttgttgccaaagttatcgcttaa

DBGET integrated database retrieval system