KEGG   Sodalis glossinidius (Glossina spp.): SG0443Help
Entry
SG0443            CDS       T00316                                 

Definition
(GenBank) penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00550  Peptidoglycan biosynthesis
sgl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SG0443
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SG0443
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sgl01011]
    SG0443
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgl03036]
    SG0443
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SG0443
Peptidoglycan biosynthesis and degradation proteins [BR:sgl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SG0443
Chromosome and associated proteins [BR:sgl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SG0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF3724
Motif
Other DBs
NCBI-ProteinID: BAE73718
UniProt: Q2NVV7
LinkDB All DBs
Position
775345..777117
Genome map
AA seq 590 aa AA seqDB search
MKAAARTMKLKRQENQTSFVSWRFALLCGCILLALLGLMLRVAYLQVINPDKLVREGDMR
SLRVQQVPTARGMISDRAGRPLAVSVPVNAIWADPKELNDHGGISADSRWKALSDALSIP
LDQLSSRINANPKGRFVYLARQVNPAIGDYIHKLKLPGIYLRQESRRYYPAGQVTAHLIG
VTNIDSQGIEGIEKSFDRWLTGQPGERTVRKDRFGRVIEDISSVDSQEAHNLVLSIDERL
QALVYRELNNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYNPNNLTGTTMDVMRNRAIT
DIFEPGSTVKPMVVMTALQRGVVRENSVLNTLPYMISGHQIKDVARYAELTVTGILQKSS
NVGVSKLALAMPSSALVETYSRFGLGKATNLGLVGESSGLYPYKQRWSDMERASFSYGYG
LMVTPLQLARVYATIGGMGVLRPLSITRVDPPVAGERVFPESLVRTVVHMMESVALPGGG
GTKAAIKGYRIAIKTGTAKKVGPDGNYINKYIAYTAGVAPASNPRFALVVVINDPQGGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALPQPGEKSDMIVNNRKEASGDRS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcagcacgcacgatgaaactgaaacgccaggagaaccagaccagctttgtc
agctggcgtttcgccttgctgtgtggttgcatcctgctggcgctgttggggctgatgttg
cgggtggcctatttgcaggtaatcaatcccgacaaactggtgcgcgaaggggatatgcgt
tcgctgcgcgtgcagcaggttcccaccgcgcgcggtatgataagcgaccgcgccggccgt
ccgctggcggtgagtgtgccggttaacgccatctgggccgatccgaaagaacttaacgat
cacggcggcatcagcgccgacagccgctggaaggcgctgtccgatgcgctttccatccct
ctcgatcagctctcctcgcgcatcaacgccaatcccaaagggcgttttgtctatttggcg
cgccaggttaatcctgctatcggcgattacatccataaacttaaactcccgggcatttac
ctgcgccaagagtcgcggcgctattatcccgcgggtcaggtgaccgcgcatctcatcgga
gtgaccaatatcgacagccagggcattgagggcatcgaaaagagttttgaccgctggctg
accggccagcccggcgagcgtacggtgcgcaaagaccggtttggccgggttattgaggat
atttcctcggtggacagccaggaggcgcacaatttggtgctgagtatcgatgagcgtcta
caggcgctggtttatcgcgagttgaacaatgcggtggcgttcaataaggccgagtccggc
accgcggttctggtggatgtcaataccggcgaagtactggccatggccaacagcccctcc
tacaaccccaacaatttgaccggcaccaccatggatgtgatgcgcaaccgcgccatcacc
gatattttcgagccgggctcgacggtcaagccgatggtggtgatgaccgcgctgcagcgc
ggcgtggtgcgggaaaacagcgtactcaatacgctgccctacatgattagcggccaccaa
atcaaggatgtggcgcgctacgccgaattaaccgtgacaggtattttgcagaaatcgagt
aacgtcggtgtgtctaagctggcgttagcgatgccgtcctcggcgctggtagaaacttac
tcgcgctttggattgggtaaggcgaccaatttggggctggtcggagaaagtagtggctta
tatccctataaacaacggtggtctgacatggagagggcctccttctcatacggctacggg
ctaatggtaacaccgttacaattagcgcgggtctacgccacgatcggcggtatgggcgtt
ttacgcccgctttccattacccgggtcgatcccccggtggcgggagagcgggtgtttccc
gaatcgctggtgcgtaccgtggtgcacatgatggaaagcgtggcgctgccgggtggtggc
ggtaccaaagccgcgatcaagggctatcgcatcgctatcaagaccggtaccgccaaaaag
gtcgggccggacggtaattatatcaataaatatatcgcctataccgccggggtcgcgccc
gccagtaatccgcgctttgcgctggtggtggtgataaacgatccgcagggcggcaaatac
tacggcggggcggtctccgcgccggtgtttggcgccatcatgggcggcgtactgcgtaca
atgaacatagagccggatgcgctgccgcagcccggtgagaaatccgacatgatcgtcaat
aatcgaaaagaggcatcaggtgaccgatcgtaa

DBGET integrated database retrieval system