KEGG   Sodalis glossinidius (Glossina spp.): SG0494Help
Entry
SG0494            CDS       T00316                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SG0494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sgl01003]
    SG0494
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sgl01011]
    SG0494
Enzymes [BR:sgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SG0494
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SG0494
Glycosyltransferases [BR:sgl01003]
 Polysaccharide
  Bacterial polysaccharide
   SG0494
Peptidoglycan biosynthesis and degradation proteins [BR:sgl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SG0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PBP1_TM UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: BAE73769
UniProt: Q2NVQ6
LinkDB All DBs
Position
853388..855799
Genome map
AA seq 803 aa AA seqDB search
MSGDDREPIGRHGRPSGRKAPRKAAPRRRRDDDYDDRWQDDDEDEEEYLMPPRKGRGGAP
RKKRRLLSWLISILLLLVVVIAIYGVYLDAQVRHRIDGKVWQLPAAVYGRMVNLEPGMSY
SRSDMATLLEGMQYREVSRITRPGEFTVRGNSIELLRRPFDFPDGKEGQIHACMTFAKNQ
LLEIKNQDTGRNFGFFRLDPRLITMLQSPKGEQRLFVPRAGFPDLLVDTLIATEDRHFYQ
HDGISLSSIGRAFLANITAGRAVQGGSTLTQQLVKNLFLTNERSLWRKANEAYMALIVDY
RYSKDRILELYLNEVYLGQSGSDQIRGFPLASLYYFGRPVDELSLDQQAMLVGMVKGASL
YNPWRNPKLALERRNLVLKLLENQQVIDGELYNMLSARPLGVQPRGGVLTPQPAFMQMVR
EELQSNLGDKINDLSGVKIFTTLDPLSQDAAEKAVEVGIPALRAGRGVKDLEAAMVVVDR
LSGEVRAMVGGAEPQFAGFNRAMQARRSVGSLAKPATYLTALSEPDKYRLNTWIADEPIT
LKQPNGSLWSPKNYDRQFRGKVMLVDALTNSLNVPTVNLGLSVGLDRITATLVKLGIPSL
VLNPVPSMLLGAISLTPMEVAQEFQTIASGGNHATLSAVRSVIGEDGAVLYQSFPQAERV
VPAQAAYLTLYAMQQVVVRGTSRSLSMKFPSSHLAAKTGTTNDLRDSWFAGIDGKEVSIA
WVGRDNNGPAKLTGANGALTLYRRYLENQAPLTLNLTPPEGISQMSIDYAGNFVCNSGSA
MRTLPVWTDDPQSLCQPAQTQVQ
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatgaccgtgaacctatcggacgtcatggacgaccgtcaggccgcaaggcc
ccgcgtaaggccgcaccgcgccgcaggcgggatgatgattatgatgaccgttggcaggat
gatgacgaagacgaagaggagtacctgatgccgccacgtaagggaaggggaggcgcgccg
cggaaaaaacgccggctgctgagctggcttattagcatcttgctgctgctggtagttgtt
atcgcgatctatggcgtgtatttggatgctcaggttcgtcaccgcattgatggcaaagtc
tggcaactcccggcggcggtctatggtcgcatggtgaacctggagcctggcatgtcctac
agccgcagcgacatggcgacgctgctggaaggcatgcagtaccgcgaggtatcgcgtatt
acccggccgggcgaattcaccgtacgcggcaacagcatcgagctgctgcgccggccgttc
gatttcccggacggcaaggagggccagatccacgcctgcatgacctttgccaaaaaccag
ctgctggaaatcaagaatcaggacaccgggcgcaattttggtttcttccgcctcgacccg
cggctgattaccatgttgcaatcgccgaagggtgagcagcggctgttcgtgccgcgcgcc
ggttttccggacctgctggtggataccctgattgccaccgaggaccggcatttctaccag
catgatggtatcagtctctcctctatcggccgcgcttttctggccaatatcactgccgga
cgcgcggtgcagggaggaagcacgctgacacagcagttggtgaaaaacctgtttttgacc
aatgaacgctcgctgtggcgtaaggccaatgaagcttatatggcgctgatcgtcgactat
cgctacagcaaggatcgcatcctggagttgtatctgaacgaggtgtatctcggccagagc
ggtagcgatcaaatccgcggctttccgttggccagcctgtattatttcggtcggccggtg
gatgagcttagtctggatcagcaggcgatgctggtggggatggtgaaaggggcgtctctg
tataatccctggcgcaatcccaaactggcgctggaacggcgcaatctggtgctgaagctg
ttggagaaccaacaggttatcgacggtgagctgtataatatgctgagcgcccgcccactg
ggggtacagccgcgcggcggggtattgacgccccagccggccttcatgcagatggtgcgc
gaagagctgcaaagcaatctgggcgataaaattaatgatctgtccggcgtcaagattttc
accacgctggacccgctgtcgcaggatgcggcggaaaaagcggttgaagtcggcatcccc
gccctgcgcgccggccgtggcgtgaaggatctggaggccgcgatggtggtggtcgatcga
ttaagcggcgaagtgcgcgcgatggtaggcggcgcggagccgcagtttgccggattcaat
cgcgctatgcaggcgcggcgttcggtgggatcgctggcgaaaccggccacctatctgacc
gccctgagcgagccggataaatatcggctcaacacctggatagccgatgaaccgattacc
cttaagcagccgaacggcagcctgtggtcgcccaaaaactacgatcggcaattccgcggc
aaggtcatgttagtggatgccttgaccaactcgcttaacgtgccgacggtcaacctcggt
ctgtcggtggggcttgatcgtattaccgcgaccctggtgaagctgggcatcccctctttg
gtactaaacccggtgccgtcgatgttgcttggcgctataagcctgacgccaatggaagtg
gcgcaggaattccagaccatcgccagcggcggtaaccatgccacactgtcagcggtgcga
tcggtgataggggaagacggtgccgtgctgtaccaaagcttcccgcaggcagagcgggtc
gtgcccgctcaggcggcgtatctgacgctgtatgcgatgcagcaggttgtggtgcgaggg
acatcgcgctcgctgtcgatgaaatttccgtcttcacatctggcggcgaaaaccgggacc
accaacgatttgcgcgatagctggttcgccggtattgacggcaaagaggtctctatcgcc
tgggtcggtcgcgataataacgggcctgccaaattgaccggcgccaacggcgcattgacg
ctgtatcgccgttatctggaaaaccaggcgccgttgacgctgaacttgacgccgccggag
ggtatcagtcagatgtccatcgattacgcggggaattttgtctgcaacagcggcagcgcg
atgcgcacattgccggtgtggaccgacgacccacagtcgctgtgccagccggcccagacg
caggtgcaatag

DBGET integrated database retrieval system