KEGG   Sodalis glossinidius (Glossina spp.): SG1123Help
Entry
SG1123            CDS       T00316                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00340  Histidine metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01230  Biosynthesis of amino acids
Module
sgl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SG1123
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SG1123
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     SG1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: BAE74398
UniProt: Q2NTX7
LinkDB All DBs
Position
complement(1866513..1867127)
Genome map
AA seq 204 aa AA seqDB search
MLTEQQRQQLDWQKTGGMMLPAIVQHAVSGEVLMLGYMNADALQATEQSGQVTFYSRSKG
RLWTKGESSGNVLRLVSIHPDCDNDTLLILAHPQGPTCHNGTSSCFHPAASDWGFLYTLE
TLLGERKNADPQSYYTASLYASGTKRIAQKVGEEGVETALAATVHDKEELTNEAADLLYH
LLVLLQDQELDLSRVIGRLRERHR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccgaacaacaacgccagcagctggattggcaaaaaaccggcgggatgatgctg
cccgctatcgtccaacacgccgtctccggcgaggttttgatgctgggctatatgaatgcc
gatgcgctgcaggcgaccgagcaatccggtcaggtgacgttttactcgcgcagtaagggc
cgactgtggaccaagggcgagagttccggcaacgttttgcggttggtcagcattcatccg
gactgcgacaacgatacgctactgattttggcccatcctcaaggtccgacctgccataac
ggcaccagcagttgtttccatcccgccgccagcgattgggggtttctgtacacgctggaa
acgctccttggcgagcgtaaaaacgccgatccgcaaagttactacaccgccagtctgtac
gccagcggcacaaaacgcatcgcccagaaagtcggtgaagagggtgtggaaaccgcgctg
gccgctacggtgcacgacaaggaggagctgaccaatgaggcggcggatctgctttatcat
ctgctggtgctgttgcaggatcaggagttggatttaagtagggtgatcggccgcctgcgc
gaacgtcaccgctaa

DBGET integrated database retrieval system