KEGG   Sodalis glossinidius (Glossina spp.): SG1513Help
Entry
SG1513            CDS       T00316                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00061  Fatty acid biosynthesis
sgl00780  Biotin metabolism
sgl01100  Metabolic pathways
sgl01130  Biosynthesis of antibiotics
sgl01212  Fatty acid metabolism
Module
sgl_M00083  Fatty acid biosynthesis, elongation
sgl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SG1513
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SG1513
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SG1513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sgl01004]
    SG1513
Enzymes [BR:sgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SG1513
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SG1513
Lipid biosynthesis proteins [BR:sgl01004]
 Fatty acid synthase
  Component type
   SG1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: BAE74788
UniProt: Q2NST7
LinkDB All DBs
Position
2546756..2547544
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILVTGVASNRSIAYGIAQSMHREGAELAFTYQNDKLKSRVEGFAADFNSSIV
LPCDVAEDASIDALFTRLADIWPTFDGFVHAIAYAPGDQLDGDYVNAVTREGFAIAHDIS
AYSFVAMAKASRAMLNPNAALVTLTYLGAERAIPNYNVMGLAKASLEANTRYMANAMGPQ
GVRVNTISAGPIRTLAASGIKNFKKMLSHCESVTPIRRVVTIEDVGNTAAFLCSDLSAGI
TGEVVHVDGGFNIAAMNELDLD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaccggtaagcgcattctggttactggcgttgccagtaaccgttcaatt
gcatacggtatcgctcagtctatgcaccgtgaaggtgcggagctggctttcacttatcag
aatgacaaattgaaatcacgggtggaagggtttgccgccgatttcaattccagcatcgtg
ctgccgtgcgacgtggcggaagatgccagcatcgacgcgctgttcacccgtctggccgac
atctggccgaccttcgacggttttgtgcacgccatcgcttacgcgcctggcgaccaattg
gacggcgattatgtcaacgccgtaacccgggaaggttttgccatcgcgcacgacatcagc
gcctacagcttcgtcgccatggccaaggccagccgggcaatgcttaatcccaacgccgcc
ctggtgacgctgacttatctgggggcggaacgagccatccccaactacaacgtcatgggc
ctggccaaagcctctctggaggccaatactcgctacatggccaacgctatgggcccgcag
ggcgttcgggtgaataccatttccgcaggccctatccgcaccctggccgcgtccggtatc
aagaatttcaagaagatgctgtcccactgcgagtcggtgacgcctatccgccgcgtggtg
accattgaggacgtcggcaacaccgccgctttcctgtgctccgatttgtcggcaggtatc
accggcgaggtggtgcatgtggacggcggcttcaatatcgccgccatgaacgagcttgat
ctggattga

DBGET integrated database retrieval system