KEGG   Sodalis glossinidius (Glossina spp.): SG2329Help
Entry
SG2329            CDS       T00316                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00564  Glycerophospholipid metabolism
sgl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SG2329
Enzymes [BR:sgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SG2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAE75604
UniProt: Q2NQH1
LinkDB All DBs
Position
3998206..3999789
Genome map
AA seq 527 aa AA seqDB search
METKDLIVIGGGINGTGIASDAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
IRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRVGLFMYDHLGKRTSLPAS
QSVRFGADSVLKPEIMRGFEYSDCWVDDARLVVLNAQEVVAHGGEVKTRTQVTRAWRKNG
LWQVEARDSLTGKQHRWHAKGLANATGPWAKHFIDESLHLPSQYGIRLIKGSHIVVPCVH
HQPQAYILQNEDHRIVFVIPWMETFSIIGTTDVEYHGDPGEVHIDESEIDYLLKVYNAHF
QRPLGREDIVWTFSGVRPLCDDESNSPQAVTRDYTLSLSDENGQAPLLSVFGGKLTTYRK
LAEYALEKLAHYYPHAKGAWTSNAVLPGGDFAGTRDDYTAVLRRKFAFLPEALARRYSHT
YGTRSEQLLAGVTGLADLGEDFGHGLYEAELRYLVAQEWVVTLDDAIWRRTKLGMWLDEA
QQTRITDWLVSTSARRGCRWRPKPLPPAGSSTGGRAPLSKSPWHIRG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgtcatcggcggcgggatcaacggtaccggcatcgcttcc
gacgctgccgggcgcggactgtccgtattattgctggaagcgcaggatttggcgtgcgcc
acctcttccgccagctccaaacttattcacggcggcctgcgctatctcgaacattatgag
attcgtttggtgagcgaagctctggctgaacgggaagttctgctgaaaatggccccccat
atcgcttttccgatgcggttccggctgccgcaccgcccacacctgcggccggcgtggatg
atccgtgtcggcctgtttatgtatgatcatctcggcaaacgcaccagcctaccggcgagt
cagagcgttcgctttggcgcggattcggtcctgaaacccgaaatcatgcgcggtttcgag
tattccgactgctgggtagacgatgcgcgcctggtagtgctcaacgctcaggaagtggtg
gcacacggtggtgaggtcaagacacgtacccaagtaacccgcgcctggcggaaaaacgga
ctgtggcaggttgaggcccgggatagtctgaccggcaaacagcatcgctggcacgcaaaa
ggtctggctaacgccaccggcccctgggcgaaacatttcatcgatgaaagcctgcatttg
ccgtcgcaatatggcatccgcctaataaaaggcagccacatcgtcgtaccgtgcgtccat
caccagccgcaggcgtacatcctgcaaaacgaggatcaccgcattgtgttcgtcattccg
tggatggaaacgttttccatcatcggtacgaccgacgtggaatatcacggcgatccgggc
gaggtccatatcgacgagagtgaaattgactatctgctcaaggtctacaacgcccatttc
caacgtcccctaggccgtgaagacattgtctggaccttttccggcgtccgccccctgtgc
gacgacgagtccaattcaccccaggcggtgacccgcgactacacgctgtcgctgagcgac
gaaaacgggcaggcgccgctgctgtcagtttttggcggcaaactcaccacttaccgcaag
ctggccgaatatgcgctggaaaaactggctcattattatcctcacgccaaaggcgcctgg
accagcaacgcggtgctgccgggtggcgatttcgccggtacccgcgacgactacaccgcc
gtgctgcgccgcaaattcgcctttttgccggaagcgctggcgcggcgctacagccacaca
tacggcacccgcagcgaacagctgctggccggcgtgaccggtcttgcggatctcggcgaa
gattttggtcacggcctgtatgaagcggaactccgttatctggtggcgcaggagtgggtg
gtcaccttggacgacgctatctggcgccgcaccaagctcggcatgtggctggacgaagcc
cagcagacgcgaattaccgactggctggtcagcacgtcagcccggcgcggctgtcgctgg
cgtcctaaacccctcccgcctgctggctcctctacaggcggacgggcgccactttccaaa
tctccttggcatattcgcggatag

DBGET integrated database retrieval system