KEGG   Saprospira grandis: SGRA_1099Help
Entry
SGRA_1099         CDS       T01764                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sgn  Saprospira grandis
Pathway
sgn00473  D-Alanine metabolism
sgn00550  Peptidoglycan biosynthesis
sgn01100  Metabolic pathways
sgn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sgn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SGRA_1099 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SGRA_1099 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SGRA_1099 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sgn01011]
    SGRA_1099 (ddl)
Enzymes [BR:sgn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SGRA_1099 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sgn01011]
 Precursor biosynthesis
  Amino acid ligase
   SGRA_1099 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFC23834
UniProt: H6L3V2
LinkDB All DBs
Position
complement(1122358..1125066)
Genome map
AA seq 902 aa AA seqDB search
MLNIGIFLAGPSREREIAFAGGRTVYDNLNKQLFRPIPIFVDSFGQLCLLDWEYLYKGSI
RDFYPPVEALPPSPHHFQIYVESLGLSKQASKELLAQIGRPISFSELPELIDFAFLSLHG
EWGEDGQLQGMLEALGIPYSGSGIRASSLGMDKSFQKKMMQAGGFESPPIQQIWAKDWSG
ELPNLEQLKKEMGFPLVVRPSNQGSSIGVRIVEQAEDLLDALENAFFGLEISAEDWQQMS
REEQIQWMRKLLDIRSGLGFPLEVEGPKKDKQLLYHPEQLLALLDKELGQGHSPKLRLQS
QYREESVLLEGFIEGREFSCVVIQDEDGQAIALPPTEIIKGKELFDYRSKYLAGLSRKLT
PIDLPEAQIQAIRQECERLFRFLEFDVYARIDGFIQADGRIILNDPNTTSGMLPSSFFFH
QAAEIGLNPSHFLSFIIHRSLLARSRKCLRPNNYGQLLARLESEMQRLEGEVAELQKVAV
ILGGYSSERHISVESGRNIYEKLASSADYLPFPVFLTGKAEDQQLYELPINLLLKDNADD
IRDKLLNYKVHPIIQKIRQETAHIANQFSGRSSRLDPRSLSFDELSEETRLAFIALHGRP
GEDGALQRELAKRGIAFNGSEADSAALTIDKYQSLQKLKAAGLPVTEQILLSKSDYLAQP
EQSLQQAGEKLGWPLIAKPVDDGCSSAVKKIKNEAELEAFLAALFREEDILPKIAQERLA
ILPKEEFPQKQYALLEQLVEQKDALHFLEVTVGLLCHHEADGSIRYEVFEPSETLASGEI
LSLEEKFLAGEGQNITPARLAVGELEYAPLAAQIKADLEQAARILGVTGYARIDAFVRIY
ADGRAETLVIEVNSLPGMTPATCIFHQTAINGYQPFDFIRQILTFGQERQAQNSLLSSSQ
ED
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacattggaatatttctggctggcccctctcgagaacgcgaaatcgcctttgca
ggtggccggaccgtctacgataatttaaataaacaactttttcggcccatccctattttt
gtggatagttttggccaactctgcctactcgattgggagtatctctataagggcagtatc
cgagatttttatcccccagtagaggcactgccgcctagcccacaccattttcagatttat
gtggaaagcctaggcctttctaagcaggcctctaaggagttgctggcccaaattggccgc
ccaattagctttagcgaattgcccgaattgatcgattttgcttttctgagtctgcatggc
gaatggggcgaagatggtcaacttcaagggatgttagaagctttggggattccctatagt
ggctctggcatccgagcgagtagcctgggcatggacaaaagtttccagaagaaaatgatg
caggcaggcggctttgaaagtcctcccatccaacaaatttgggccaaagactggagcggc
gaattgcccaatctggagcagctcaaaaaagagatgggtttccccttggtggtccgccct
tccaatcaaggttcttctatcggtgtgcgtattgtcgagcaggctgaagaccttctcgat
gccctagaaaatgccttttttggcctcgaaattagcgccgaagactggcagcaaatgagc
cgagaggagcagatccaatggatgcggaaattgctcgatattcgctctggcctcggcttc
ccgctagaggtggaaggcccaaaaaaagataaacagttgctctatcatcccgagcaatta
ttggccctactcgataaggaattggggcagggacatagccccaagctccgactccaaagc
caataccgagaggaaagcgttttattagagggctttattgagggccgagagttttcctgt
gtcgtgattcaagatgaggatggccaagccattgctttgccccccaccgaaattatcaag
ggcaaagagctttttgattatcgctctaagtatttggctggactctcgcgtaagttaacc
cctattgatttgcccgaggcccaaatccaagcgatccgccaagagtgcgaacggctgttc
cgctttttggagtttgatgtttatgcccgaatcgatggttttattcaagccgatggccgc
attattctcaatgatccgaatacgacttcgggcatgctgccttcttctttctttttccat
caagcggccgaaattggcctcaatccctcgcattttctcagttttattattcatcgctcg
cttttggcccgcagccgaaaatgcctgcgccccaataattatggccaattattggcccga
ttggaaagcgagatgcaacgcctagaaggagaggttgccgaactccaaaaggtggcggtt
attctaggcggttattcttccgaacgccatatttcggtagaaagtggccgcaatatttat
gagaagttggccagctctgcagattatctgccttttcccgttttcctgacgggcaaggcg
gaggaccaacagctctacgaattaccaatcaaccttttgctaaaggataatgccgacgat
attcgcgataaattattaaattataaggtacatcccattatccaaaagattcgccaagaa
acggctcatattgctaatcagttttctggccgaagtagccgcctagatccccgctcgctc
tcttttgatgaattaagcgaggagacccgtctggcctttatcgctttgcatggccgcccc
ggcgaggatggcgcgctccaaagagagttggccaaaagaggcatcgcttttaatggttcg
gaggccgattctgctgccttgacgattgataagtaccaaagtctccaaaagctgaaagcc
gctggcctgcccgtgaccgagcaaatccttttgagcaaaagcgattatttggcccagcct
gaacaaagtctgcagcaagcaggcgaaaaactaggctggcccctgattgccaagccagta
gatgatggctgtagctctgccgtgaaaaagatcaaaaatgaggcggaattggaggccttt
ttggcggcccttttccgtgaagaggatattttgccaaaaattgcccaagagcgcctagcc
attttgcccaaagaggagtttccccaaaagcaatatgcccttttagagcagttggtggag
caaaaagatgccctgcattttctggaggtgaccgtgggcctactttgtcatcatgaggcc
gatggaagcatccgctatgaggtttttgagccttctgaaaccttggcttctggcgagatt
ttatcgttggaagagaagtttttggcgggagagggacaaaatattacccctgctcgcttg
gctgttggcgaacttgaatatgcgcccttggcggcccaaattaaggccgatttagagcag
gcggcccgcattttgggggttacgggctatgcccgaatcgatgcttttgtccgcatttat
gccgatggccgagccgaaaccctggtcattgaggtcaattctttgcccggcatgacgccc
gccacctgcatcttccaccaaacggccatcaatggttatcagcccttcgattttattcgg
cagattctgacttttggccaagagcgacaagcgcaaaacagtttgttgtcttcttctcag
gaggattag

DBGET integrated database retrieval system