KEGG   Saprospira grandis: SGRA_3788Help
Entry
SGRA_3788         CDS       T01764                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sgn  Saprospira grandis
Pathway
sgn00240  Pyrimidine metabolism
sgn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGRA_3788 (tdk)
Enzymes [BR:sgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SGRA_3788 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: AFC26504
UniProt: H6L8E0
LinkDB All DBs
Position
3899388..3899942
Genome map
AA seq 184 aa AA seqDB search
MNGKLHLILGPMFSGKSTLLLTRYRRYRIAGKACLLVKYAKDCRYDDSAAMIVTHDKLRY
EATACTKLAELDDLVQDYDVICIDEIQFYPDAADFADRWANQGKIVECCGLSGDYKREPF
EQISRLIPRCDDITHVKAVCKSSGLDAPFSQRFSQEEEQEVIGGSDKYQAVSRAVYLQQQ
KKED
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaaaattacaccttattttgggcccgatgttctcgggcaagagcaccctctta
ctcactcgctaccgccgctatcggattgcgggaaaagcttgtttattagtgaaatatgcc
aaagactgccgctacgacgattctgcggccatgattgtgacgcatgacaaactgcggtat
gaagccacggcttgcacaaaattagccgaactagacgatctggtccaggattatgatgtc
atttgcattgacgaaattcagttttatcccgatgcggctgattttgccgaccgttgggcc
aatcagggtaaaattgtagaatgttgtggcctcagcggagactacaaaagagagcccttt
gagcaaatcagccgcttgattcctcgctgcgatgatattacgcatgtaaaagcggtttgt
aagagctcgggcttagatgcgccctttagtcagcgcttttctcaggaagaagaacaggag
gtaattggaggctctgataagtatcaggcggtatctagagcggtctatttacagcaacag
aagaaagaagactaa

DBGET integrated database retrieval system