KEGG   Streptococcus gordonii: SGO_0429Help
Entry
SGO_0429          CDS       T00594                                 

Definition
(GenBank) aspartate transaminase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00220  Arginine biosynthesis
sgo00250  Alanine, aspartate and glutamate metabolism
sgo00290  Valine, leucine and isoleucine biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01130  Biosynthesis of antibiotics
sgo01210  2-Oxocarboxylic acid metabolism
sgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGO_0429
   00290 Valine, leucine and isoleucine biosynthesis
    SGO_0429
   00220 Arginine biosynthesis
    SGO_0429
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgo01007]
    SGO_0429
Enzymes [BR:sgo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SGO_0429
    2.6.1.66  valine---pyruvate transaminase
     SGO_0429
Amino acid related enzymes [BR:sgo01007]
 Aminotransferase (transaminase)
  Class I
   SGO_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABV11105
UniProt: A8AVD5
LinkDB All DBs
Position
473692..474906
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSVKLEHVAYDIRGPVLEEAMRMRANGERILRLNTGNPAEFGFTAPDEVIHDLII
NARSSEGYSDSKGLFSARKAIMQYCQLKNIPNVGIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEEADWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPKEVLEDIVEIARQNDLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMALSGPKKHVQGYIEGLNMLSNMRLCSNVLSQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYKAINDIPGLSAVKPKAGLYIFPKIDREMYEIDDDEQFVLNFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQVQEKMTRFLQQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatacaataaatctgtcaaactagagcatgtagcatatgatattcgtggccca
gttctcgaagaagctatgcgcatgcgagcgaatggtgaacggattttgcgtttaaatact
ggaaatccagctgagtttggctttactgctccagatgaagtcatccatgacttgattatc
aatgctcgtagtagtgaaggctattctgattctaagggattgttttcggctcggaaggct
attatgcaatattgccagctcaaaaatattcctaacgttggaattgaagacatttaccta
ggaaatggtgtcagtgagctgattgtgatgtctatgcaaggcctgctagacaatggagat
gaagttctggttcctatgccggattatccattgtggacagcggcagtgagcctagctggc
ggaaacgcagttcattatctttgtgatgaagaagcggattggtatccagatattgatgac
attaaatcaaaaattacttcaaataccaaagctatcgttgtgattaatcccaataaccca
acaggagccctgtatccaaaagaagtattggaagatattgttgagattgcccgtcagaat
gatttgattatctttgcggacgagatctatgaccgtttggttatggacggtgagaagcat
acagctattgcaagcctagcgcccgatttattctgtgttagcatgaatggtttgtcaaaa
tctcaccgcattgcaggtttccgggtcggctggatggcgctatcaggtcccaaaaagcat
gttcaaggctatattgaaggattgaacatgctgtccaatatgcgtctctgttccaatgtt
ctttcccaacaggtggttcaaacttcattgggagggcatcagtctgtggacgagctattg
ttgccgggcggtcgtatctacgaacagcgtaacttcatttataaagctatcaatgatatc
ccgggtctttctgcagtcaagcctaaggcaggtctatacatttttcctaagattgatcgc
gaaatgtatgagatcgatgatgatgagcagtttgttttaaatttcttaaaacaagaaaaa
attctgctagttcatggccgtggcttcaattggaaggatcctgatcatttccgaattgta
tatttgccacgtgtggatgaattggcccaagtgcaagaaaaaatgactcgtttcttgcaa
caataccggcgctaa

DBGET integrated database retrieval system