KEGG   Streptococcus gordonii: SGO_0760Help
Entry
SGO_0760          CDS       T00594                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00620  Pyruvate metabolism
sgo00680  Methane metabolism
sgo01100  Metabolic pathways
sgo01120  Microbial metabolism in diverse environments
sgo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGO_0760 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SGO_0760 (ppc)
Enzymes [BR:sgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGO_0760 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DICT
Motif
Other DBs
NCBI-ProteinID: ABV09428
UniProt: A8AW99
LinkDB All DBs
Position
798325..801171
Genome map
AA seq 948 aa AA seqDB search
MSFNKLESFSNKEVIREEVSILTDLLTDVTRKILSPETFEKIAMMEDLAVHSKYQELKEI
VEELTTEEMVYISRYFSILPLLINISEDVDLAYEINHQNNIDQDYLGKLSTTIDLISTRE
NAKEILENLNVVPVLTAHPTQVQRKTMLDLTNHIHTLLRQHRDVKAGLVNEKKWLGNLRR
YIELMMQTDMIRDKKLKVTNEITNVMEYYNSSFLQAITNFMVEYKRLAEERGIKLDNPKP
ITMGMWIGGDRDGNPFVTAETLKLSATLQSEVILNYYIDKVYTLYRTFSLSTNLSETSQA
VAEMAALSTDKSVYRENEPYRRAFHYIQSKLIQTLLYLKEGNFSNEGQRLTDRAEKTLSA
KTTPSLSNKGREIIPNYIQSRISETLTELKKEETPSYKTAKEFKEDLQVIYDSLIEHHGE
ALVTGDLTELLQAVDVFGFFLASIDMRQDSSVHEACVAELLASANIVKDYSSLSEEEKCQ
VLLKQLLEDPRILSATHEPKSELLQKELEIFKTARQLKDALGEEVIKQNIISHSTSVSDL
LELAIMLKEVGLIDENGTRVQIVPLFETIEDLDNSCETMEKYLSLPIAQKWIASKNNYQE
IMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDKFGVKITFFHGRGGTVGRGGGPTYEAI
TSQPLRSINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMVTHKKSDAHTSNKY
ERIMDQVVERSYQIYRDLVFGDERFYDYFFESSPIKAISSFNIGSRPAARKTITEIGGLR
AIPWVFSWSQSRVMFPGWYGVGSSFKEFIDQDPENNLAFLQLMYKRWPFFKSLLSNVDMV
LSKSNMNIAFEYAQLCEDQNVRDIFNIILDEWQLTKNVILEIEGHDELLAENTYLRDSLD
YRMPYFNVLNYIQLELIKRQRNGQLTPDQEKLIHITINGIATGLRNSG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaataagttagaaagctttagtaataaagaggttattcgagaagaagtttcc
attttgacggacttacttactgatgttacgcgtaaaattcttagtcctgagacattcgaa
aagattgcaatgatggaggacttagctgttcactccaaataccaggaactaaaggaaatc
gtagaagaactaacaacagaagaaatggtctatatttctcgttatttttctattcttcca
ctcttgattaatatttctgaagacgttgatctagcctatgaaatcaaccatcagaacaat
attgaccaagattatcttggaaagctatcaacaactattgacttgatttcaacgcgggag
aatgcaaaagaaattctagaaaatttaaatgttgttccggtactgactgctcacccaact
caagtgcaaagaaagacaatgctggatctgacaaatcatattcacacccttttgcgtcag
catcgagatgttaaggctggtctggttaatgagaagaagtggctaggcaaccttcgtcgt
tacatcgagctcatgatgcagacagatatgattcgggataagaagctaaaagtaaccaat
gaaattaccaatgttatggaatactacaatagctcttttctacaagccattaccaacttt
atggtcgaatacaaacgcttggcagaagagcggggtatcaagttggataatcctaaacct
attaccatgggaatgtggattggtggtgaccgggatgggaatccttttgtaacggcagaa
actttgaaactatcagccactctccagagtgaagtcattctcaactattacattgacaag
gtttatacactttatcgtactttttctctgtcaacaaatctctcagaaactagtcaggca
gtagcagaaatggctgctttgtcaactgataaatctgtttatcgtgaaaatgaaccttac
cgccgtgccttccactatattcagtccaagctgattcagaccttgctgtacctgaaagaa
ggaaacttttctaatgaaggtcagcgcttgactgatcgagctgagaaaacattatctgcc
aagacaactccttctttgagtaataagggacgggaaattattccaaactatattcagtct
cgtatcagtgaaaccttaactgagttgaagaaggaggaaacaccttcttacaaaactgca
aaagaattcaaagaagacttacaggtcatttatgattctcttatcgaacatcatggtgag
gctttagtgacaggagacctgacagaacttttacaagcagtggatgtttttggtttcttc
ttagccagcattgatatgcgtcaggattctagtgttcatgaagcttgtgtggctgagctc
ttggcatcagcaaacattgtaaaagattacagcagcttatctgaggaagaaaaatgtcag
gtactacttaagcaattgcttgaggatcctcgcattttatcagctactcatgagcctaag
tccgaacttttgcaaaaagaattagaaattttcaagactgctcgacagctgaaagatgca
cttggtgaagaagtcatcaagcagaacatcatttctcactcgaccagtgtatcagaccta
ctggagttggctattatgctgaaagaagtaggactgattgatgaaaatgggactcgagta
cagattgttcctctttttgagacaattgaagatttggacaattcatgcgaaacaatggag
aagtatctatctttgcctattgctcagaagtggattgcctctaagaataattaccaagaa
atcatgttgggttactcagacagtaataaagatggtggttacctatcttcttgctggact
ctctataaggctcagcaacagctgactgctattggtgataaatttggtgttaaaattacc
ttcttccatggtcgtggaggtacagttggtcgtggtggcggtccaacctatgaagcgatc
acctcacaacccctacgaagtatcaacgaccggatccgccttactgagcaaggggaagtt
attggaaacaaatatggtaataaagatgcagcctactataatttggaaatgctcgtttct
gcagcaatcaatcgaatggtaacacataagaaaagtgatgcccatacatccaataaatat
gagcggatcatggatcaagttgtcgagcgaagctatcagatttatcgtgatttagtcttt
ggcgacgaacgcttttatgattatttctttgaatctagtccaatcaaagcgatttctagc
tttaatattggctctcgtcctgcagctcgtaaaacgattactgaaatcggtggtcttcga
gcgatcccatgggtcttctcatggtctcaaagtcgagtgatgttccctggttggtacggt
gttggctcaagtttcaaggaatttattgatcaagatccagaaaataaccttgcctttcta
caacttatgtacaagagatggccattcttcaaatctctattatcaaatgtagacatggtc
ctttctaagtccaatatgaacattgcttttgaatatgctcagttatgcgaagatcagaat
gttcgggatattttcaatattatcttggatgagtggcaactaactaagaatgttattctt
gagattgaaggacacgatgaactcttggctgaaaatacttatctaagagacagcttggac
tatcgtatgccttactttaatgttttgaactatattcaactagagctgattaaacgtcaa
cgcaatggtcagctaacgcctgatcaagagaagttgattcacatcactattaatggtatt
gcaactggtttgcgaaactcaggttaa

DBGET integrated database retrieval system