KEGG   Streptococcus gordonii: SGO_0779Help
Entry
SGO_0779          CDS       T00594                                 

Definition
(GenBank) response regulator
  KO
K07668  two-component system, OmpR family, response regulator VicR
Organism
sgo  Streptococcus gordonii
Pathway
sgo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SGO_0779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sgo02022]
    SGO_0779
Two-component system [BR:sgo02022]
 OmpR family
  VicK-VicR (cell wall metabolism)
   SGO_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABV10634
UniProt: A8AWB8
LinkDB All DBs
Position
818820..819521
Genome map
AA seq 233 aa AA seqDB search
MKKILVVDDEKPISDIIKFNMVKEGYEVVTAFDGREALEMFEAENPDILILDLMLPELDG
LEVARTIRKTSNVPIIVLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKAILRRSE
FAVDTQENEKGSNELTVGELQILPDAFVAKKHGEELELTHREFELLYHLASHVGQVMTRE
HLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMRNND
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatattagttgtagatgatgaaaaaccaatttcagatattataaaatttaat
atggtaaaagagggctatgaagttgttacggcttttgatggtcgtgaagctcttgagatg
tttgaagctgaaaatcctgatattttgattttggatttgatgttgccagagttggacggg
ctagaagtagcacgcaccattcggaagaccagtaatgttccaattattgtcctatcggct
aaagatagtgagtttgataaagttatcggccttgagatcggagcagacgactatgtgact
aagcctttctctaaccgtgagctccaagctcgtgtcaaggctattttgcgacgttcagaa
tttgctgtagatacccaagaaaatgaaaagggctcaaatgagttgacagtgggtgaattg
caaattttacccgatgcttttgttgccaaaaaacatggtgaagagctagaattaacccat
cgtgagtttgaattactctaccatttggctagtcatgttggtcaagtaatgacacgcgaa
cacctgttagagacagtttggggttatgattattttggtgatgtacgcactgttgatgtg
acgattcgccgtctacgtgaaaagattgaagatacgccaagccgaccagagtatatttta
actcgtcgtggtgttggctactatatgagaaacaatgattga

DBGET integrated database retrieval system