KEGG   Streptococcus gordonii: SGO_1075Help
Entry
SGO_1075          CDS       T00594                                 

Definition
(GenBank) alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00500  Starch and sucrose metabolism
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGO_1075
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SGO_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ABV10115
UniProt: A8AX54
LinkDB All DBs
Position
complement(1119068..1120519)
Genome map
AA seq 483 aa AA seqDB search
MKNQTLMQYFEWYLPDDGQHWNRLAMDAPNLAAKGIKKIWMPPAFKATGSNDVGYGIYDL
FDLGEFDQKGTVRTKYGFKDEYLQAIQALKDNGIDPIADVVLNHKAAADGTETFTVIEVD
PNDRTTAISEPFMIKGWTHFTFPGRNKQYNDFEWHWYHFTGTDFDAKSRRSGIYLIQGDN
KGWANDELVDSENGNYDYLMYADLDFKHPDVIKNLYDWAKWFIETTGIQGFRLDAVKHID
SFFMANFIRDILQEYGDDFYVFGEFWNNDEAANNDYLENIDYRFDLVDVKLHTNLFEASQ
KGEEYDLRTIFDHTLVKNHPESAVTFVENHDTQRGQALESTVEEWFKPAAYALILLRESG
LPCIFYGDYYGINGEFAQQDFQEEIDKLLDLRLNLAYGEETDYFDDPNCIGWTRAGQDGS
QPIAVLISNASATSKRMYFGQDWSGHECSDYLGNCQTIVTIDEEGWGVFPVEEQSVSVWS
IKK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaaactttaatgcagtattttgaatggtatcttccagatgatggccagcat
tggaatcgtttagcaatggatgcgccaaatctagcagccaaaggaattaaaaaaatatgg
atgcctccagcttttaaagcaactggctcaaatgatgttggctatggcatttacgattta
tttgatttaggagagtttgatcaaaaagggacagttcggactaagtacggattcaaagac
gaataccttcaagcaatccaagcacttaaagataatggaatcgatccaattgctgatgtc
gttttaaatcataaagctgcagccgatggaactgaaacatttacggttattgaagtagat
ccaaatgaccgtactactgctatttctgaaccctttatgattaaaggatggactcacttt
acttttccaggaagaaacaagcaatataatgattttgaatggcattggtatcatttcact
ggaactgactttgatgcaaaaagtcgacgctctggtatttatttaattcaaggtgacaat
aaaggttgggcaaatgatgagctggtagacagcgaaaacggaaactatgactatctaatg
tatgccgatctagatttcaaacatccagatgttattaaaaatttatacgattgggctaaa
tggtttatcgaaactactggtatacagggcttccgattggacgcggttaaacatatagat
tccttctttatggcaaactttattcgagatattttgcaagaatatggtgatgatttctat
gttttcggagagttttggaataatgatgaagctgctaataatgactacttagaaaatatt
gactatcgcttcgatcttgtcgatgttaaattgcatactaatctttttgaagcaagccaa
aaaggtgaagaatatgacttgcgtactatttttgatcatactttagtaaaaaatcaccca
gaatcagctgtgacatttgtagaaaatcatgatactcagcgtggtcaagctcttgaatcc
actgtagaagaatggtttaaaccggcagcttatgctcttattctacttcgagagtctggc
ctcccatgtattttctacggagactactatggcataaatggtgaattcgctcagcaagat
ttccaagaagagatcgacaaactattggaccttcgtctaaacctagcttatggtgaagag
accgactactttgatgaccctaattgtatcggatggacaagggctggtcaagatggtagt
cagcctattgctgttttaatttcaaatgcttctgctacttcaaaacgaatgtattttggc
caagattggtcagggcacgagtgttccgactaccttggtaattgccaaacaattgtcact
atcgatgaagaaggctggggagtgttccctgttgaagaacaatctgttagcgtttggtct
attaaaaaataa

DBGET integrated database retrieval system