KEGG   Streptococcus gordonii: SGO_1366Help
Entry
SGO_1366          CDS       T00594                                 

Gene name
pheA
Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01130  Biosynthesis of antibiotics
sgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGO_1366 (pheA)
Enzymes [BR:sgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     SGO_1366 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-ProteinID: ABV09490
UniProt: A8AXY7
LinkDB All DBs
Position
complement(1409666..1410493)
Genome map
AA seq 275 aa AA seqDB search
MLVGYLGPKGSFSHQVAQKAFPEANLEPYPNITEVIKAYERGQVDLSIVPVENSIEGSVH
ETLDYLFHQAQIQAVAELIQPIKQQLLACQTDGPIETIFSHPQALAQSKTYIQEHYPYAQ
LEVTASTAAAARLVAKHPEKPYAAIAPETAAEEYGLQLVARDIQEISENFTRFWVLGPKK
PEFALEKLAPKKTLGLTLPDNIPGALYKALSVFAWRGIDLTKIESRPLKTALGEYFFIID
VNGEQESLLQFALEELTAIGITYKILGQYSVHLIA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtaggctatcttgggcccaagggctctttttctcatcaagtggctcaaaaagct
tttccagaagcaaatttagagccctatccaaacatcacagaagtcatcaaggcttatgaa
agaggtcaagtggacctatccattgttccagttgaaaattcaattgagggcagtgttcac
gagactttggattatctttttcatcaggcccagattcaagctgtagcagagttgattcaa
ccaattaagcaacagctcctagcctgtcagactgatggaccgatagagacaatcttttct
catccgcaagctcttgctcagtctaagacttatattcaggagcattatccatacgctcag
ttggaagtaactgctagtacagctgcagcagcacggttagtagccaaacatccagagaag
ccttatgctgctattgcaccagaaacggctgctgaggagtatggtttacaacttgtggca
agagatatccaagaaataagcgaaaatttcacacgtttttgggttttaggacctaagaaa
cctgagttcgctttggaaaaacttgctcccaaaaagaccttgggcttgaccttgccggac
aatataccgggtgctctctataaggccttgtctgtctttgcttggcgagggattgacttg
accaagattgaaagtcggcctctaaagacagcactgggagaatatttctttatcattgat
gtcaatggtgaacaggagtctctactccaatttgctttggaagaattaacagccatcgga
attacttataaaattttaggacagtatagtgtccatcttattgcataa

DBGET integrated database retrieval system