KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0476Help
Entry
SpiGrapes_0476    CDS       T01673                                 

Definition
(GenBank) 3-dehydroquinate synthetase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgp01100  Metabolic pathways
sgp01110  Biosynthesis of secondary metabolites
sgp01130  Biosynthesis of antibiotics
sgp01230  Biosynthesis of amino acids
Module
sgp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiGrapes_0476
Enzymes [BR:sgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     SpiGrapes_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AEV28331
UniProt: G8QWN7
LinkDB All DBs
Position
complement(519181..520242)
Genome map
AA seq 353 aa AA seqDB search
MKSLSTTTLANGKQTEILIADNLKDLSAHLGSYGRSVLWVFDANTATLFKQLPPVNVVLE
SGESSKNFSSLERILSNAVDEGLARDCRIIGFGGGVVCDMAAFAASVFMRGCKLTLVPTT
LLCMVDASVGGKTAIDFKGLKNMVGSFYPAEEVLISMDTLRTLPEKEYLNGLAEVIKHAL
LSQDEQLYKFLLVKKNEILSRDIETLQTLVTLSLAVKQWYIEQDPTETKGIRQVLNLGHT
FGHALESSGHFTFGHGACVAWGTCRALEAGVNMGITDKAYAIGATKLFKSYGYDIDYRIG
RGDWIEFRERLSKDKKKEKGQVLFVLMESQGKAVLRPIDMALVQHLVIAKPIF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttatcaacaacaactcttgccaatggcaaacagactgagattttaattgcc
gataatctgaaagacctttcggctcacctgggcagttacgggcgttcggtcctttgggtt
tttgatgccaacacggcaacgcttttcaaacagttgccaccggttaatgtagttctcgaa
agcggggaaagttccaagaacttttcctctttggaaaggattctctccaacgcagtcgat
gaaggcctggcaagggattgccggataatcggcttcggagggggcgtggtctgtgacatg
gcagcctttgctgcttctgtattcatgcgcggttgtaaattgactctggtacccactacg
ctgctctgtatggtagatgcctcggtgggaggtaagactgccatcgatttcaagggtctg
aagaacatggtcggatccttctatcctgcagaagaagtactgatcagtatggatacgctt
cgtacgcttccggaaaaagaatacctcaatggactggctgaagtgatcaagcatgccctt
ctcagccaggacgagcaattgtacaagtttctcttggtcaagaaaaacgaaatcctctca
cgcgatattgaaaccctgcagactttggttaccctctcgcttgcagtaaaacagtggtat
atcgaacaagatcctaccgagaccaagggcattagacaggttctgaaccttgggcatacc
tttggccatgctttggaatcctcgggtcattttacgtttggccatggggcctgtgttgcc
tggggcacctgtagggccctggaagcaggtgtcaacatgggcattaccgacaaagcctac
gcaatcggggcgaccaagctcttcaaatcctatgggtatgatatcgattaccgcattggc
cgcggggattggatagagttcagggaacggttgtcaaaggacaaaaagaaagagaagggc
caagtcctgttcgtcctgatggaaagccagggcaaggccgttctccgtccgatagatatg
gctctcgttcagcatctggttattgcaaaaccgatcttctga

DBGET integrated database retrieval system