KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2363Help
Entry
SpiGrapes_2363    CDS       T01673                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
Organism
sgp  Sphaerochaeta pleomorpha
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N AlaDh_PNT_C Shikimate_DH Pyr_redox_2 Pyr_redox UDPG_MGDP_dh_N Methyltransf_25 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEV30137
UniProt: G8QSV5
LinkDB All DBs
Position
2590543..2591538
Genome map
AA seq 331 aa AA seqDB search
MRAIVIEKPGMISVREVPIPVVNEDEVLIKVMSSGICGTDVHIFHGEYLGSYPIIPGHEF
SGIVEKVGKQVKRIKVGDHVAVEPNIACDNCENCLENRQNFCANWQGVGVSMPGGMAEYV
KAPEKAVFSIGKLPFDEGAFCEPLSCVLHGIEQVPLKLGDRVLVLGAGPIGMLLAQTAKI
RGACTITQVDKNESRLEMAKAYAADVVCNDLESLKGQVFDVVIEASGSKYLLENSVHYAR
GGGSVLFFGVPKNDLMILLSPFEIFSKSLRIMGTYTSVRNSMQAIRLMESHQIDVRPLIN
PVLPLTSFNQGVQSLVEGKAGVMKVMIKPQQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatagtgattgaaaaacccggtatgatttctgtaagggaggtacctattcct
gttgtcaacgaagatgaggtacttataaaagtaatgtccagtgggatatgcggaacagat
gtgcatattttccatggggaatatcttggctcttacccgatcatcccaggtcatgagttt
agtggaatcgtggaaaaagtcggcaaacaggtaaaacggataaaagtaggtgaccatgtg
gctgtagaaccaaatatcgcctgcgataattgtgaaaactgccttgaaaaccgacagaat
ttttgtgctaactggcaaggggtaggggtttcgatgccaggaggaatggctgaatatgtt
aaagctcctgaaaaagcagtgttttcgattggaaaactgccctttgacgagggggcattc
tgtgaacccttgtcctgtgttttgcatgggatagagcaagttcccctaaaactgggtgat
agggttttggtacttggagctggacctatagggatgttgcttgctcaaacagccaaaatt
cgtggagcttgcacaattacccaagtggataaaaatgaaagcagacttgaaatggcaaag
gcgtatgcagctgatgtggtctgtaatgatctcgaatcccttaaaggtcaggtatttgac
gttgtaattgaagcttctgggtcgaagtatttgttggaaaatagtgtgcactatgcccgg
ggtggtggctcagttttgttttttggcgtaccgaagaacgaccttatgatccttctgagc
ccttttgaaattttttcaaagagcctgagaattatggggacctatacgtctgtaagaaac
tcaatgcaagcgattcgtcttatggaaagtcatcagattgatgttaggcctcttattaat
cctgtgttgcctcttacctcttttaatcagggggtgcagtccttggttgagggaaaggca
ggggttatgaaagtgatgatcaaacctcagcaataa

DBGET integrated database retrieval system