KEGG   Sphaerochaeta pleomorpha: SpiGrapes_3031Help
Entry
SpiGrapes_3031    CDS       T01673                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00040  Pentose and glucuronate interconversions
sgp00051  Fructose and mannose metabolism
sgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SpiGrapes_3031
   00051 Fructose and mannose metabolism
    SpiGrapes_3031
Enzymes [BR:sgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SpiGrapes_3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 SR1P
Motif
Other DBs
NCBI-ProteinID: AEV30779
UniProt: G8QYD2
LinkDB All DBs
Position
3301014..3301991
Genome map
AA seq 325 aa AA seqDB search
MAKHSIILGNVGNFTDRFMGVGYQRDYTLEEMFDRVKSVKGVTGVELVGNWHINERNFKQ
VKKNLERTELSLVSIIPDHFGIPEYGKGAFTSKDPKIREKAVSDTKVMIDIAVELGGDLI
SLWPGQDGYDYFFQGNYIDERGWFEEGVRACCTYRPSCKISIEYKPKEPRNFSYASNVTS
TLLMVQQINLSNLGVTIDYGHGSVAGENLAESVAILKKYGNKLFHVHMNDNYGSWDDDMI
TGSIHTIPFIEFFYWLKKTGYEGYISTDQYPYREDGRDACNESVRWFDVFESMVDRIDEQ
KITALYETGNACDISAFLRDLMFGR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcatagtatcattctcggaaatgtcggaaattttacagaccgattcatgggt
gttggttaccagagggattataccttggaggaaatgttcgatagggtaaaatcggtgaaa
ggggtcacaggggtcgagttggtaggcaattggcatattaacgaaagaaacttcaagcag
gtcaaaaaaaacctcgagaggactgaactttccctggtatcgatcattcctgatcatttc
gggatacctgagtatgggaagggggcttttacttcaaaagacccgaagatccgggaaaaa
gcagtatctgatacgaaagtgatgatagacatagccgttgagctaggtggcgatttaatc
agcctatggcctgggcaggatggatatgactatttcttccaagggaattacatagacgag
aggggttggtttgaggaaggcgtcagggcctgctgtacctatcgcccgagttgcaagatc
tcaatcgaatataaaccaaaggaacctaggaatttcagttatgcttcaaacgttacgtca
acgctactgatggttcaacagatcaacctttccaacctaggggttaccattgactatggc
catggctcggtagccggtgagaatcttgctgagagtgtagccattctcaaaaaatatggt
aacaaactgtttcatgtgcatatgaatgataattatggttcttgggatgacgatatgata
accggttccatccataccatcccatttatagagtttttttactggttgaagaagactggc
tatgaaggctatatctcaacagaccaatatccgtacagggaagatggcagggatgcctgt
aacgagtctgtacggtggtttgatgtgtttgaatcaatggtggacaggatagacgaacaa
aagattacagcactttatgaaacaggaaatgcctgtgatataagcgcattcctgcgtgac
ttgatgtttgggaggtga

DBGET integrated database retrieval system