KEGG   Streptomyces griseus: SGR_1024Help
Entry
SGR_1024          CDS       T00691                                 

Definition
(GenBank) putative DNA ligase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: BAG17853
Kitasato: SGR1024
UniProt: B1VU09
LinkDB All DBs
Position
1212873..1213934
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVKPMLAKSVSRIPPGMSYEAKWDGFRAIVYRDGDEVEIGSRTGKSLTRYFPD
LVDVVRDRLPPRCVIDGEIVIAHEGRLDFERLGERIHPADSRVRLLAEQTPASLIAFDVL
AVDDTSLLSTRQADRREVLRAALADASAPVFLAPATTDIEVAREWFDRYEGAGLDGIVAK
PLDLPYRPDARAMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDSDGVLQHVGVCAA
FPMKRRAELAEELAPLRIEFAEHPWAAWAEAAAHERSRLPGTQNRWSGKKDQSWVPLRPE
RVCEVAYDHMEGDRFRHTTQFRRWRPDRSPAGCTYAQLEEVVSYDLSEVLSGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcccgtgaagccgatgctcgccaagtcggtgtccaggatc
ccgccgggcatgagctacgaggcgaagtgggacggtttccgggcgatcgtgtaccgggac
ggcgacgaggtggagatcggcagccgcacgggcaagtcgctgacgcgctacttccccgac
ctggtcgacgtcgtccgcgacagactcccgccgcgctgtgtgatcgacggggagatcgtc
atcgcccacgaggggcggctcgacttcgagcggctcggggagcgcatccatccggcggac
tcccgggtgcggctgctcgccgagcagaccccggcgagcctgatcgccttcgacgtcctc
gccgtcgacgacacctccctgctctccacccggcaggcggaccggcgggaggtgctgcgg
gccgcgctcgcggacgcgtccgcgcccgtgttcctcgccccggccaccacggacatcgag
gtcgcccgggagtggttcgaccggtacgagggggccgggctcgacgggatcgtcgccaaa
ccgctcgatctcccctaccggccggacgcccgggcgatgtacaagatcaagcacgagcgg
accgccgacgtcgtggtggcggggtaccgcgagcacaagagcggcccggtcgtcggctcg
ctcctgctcggcctgtacgactccgacggcgtgctccagcacgtcggggtctgcgcggcc
ttcccgatgaagcggcgcgccgagctggccgaggaactggcgccgctgcgcatcgagttc
gccgagcacccctgggccgcctgggccgaggcggcggcgcacgagcggtcccggctgccg
gggacgcagaaccgctggtcgggcaagaaggaccagtcgtgggtgccgctgcgcccggag
cgggtgtgcgaggtggcctacgaccacatggagggcgaccggttccggcacaccacccag
ttccgtcggtggcggccggaccggtcccccgccggctgtacgtacgcgcagctggaggag
gtcgtctcctacgacctgtccgaggtgctgtcgggcggctga

DBGET integrated database retrieval system