KEGG   Streptomyces griseus: SGR_2245Help
Entry
SGR_2245          CDS       T00691                                 

Definition
(GenBank) putative superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sgr  Streptomyces griseus
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGR_2245
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SGR_2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: BAG19074
Kitasato: SGR2245
UniProt: B1W149
LinkDB All DBs
Position
2660944..2661339
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRTRAVLIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLINDTLKALSAAKGSNDPKTGQKALDLIAE
VDRIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtgaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtcggtcaaggccgtccaggag
aagtaccaggccaacgaggacgcggacttccgcacccgcgccgtcctgatcaaggagcag
cgcgccgagctcgcgaagcaccacgtctcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctgatcaacgacaccctgaaggcgctctcc
gcggccaagggctcgaacgacccgaagacgggccagaaggccctggacctgatcgccgag
gtcgaccggatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system