KEGG   Streptomyces griseus: SGR_2459Help
Entry
SGR_2459          CDS       T00691                                 

Definition
(GenBank) putative secreted subtilisin-like serine protease
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Inhibitor_I9
Motif
Other DBs
NCBI-ProteinID: BAG19288
Kitasato: SGR2459
UniProt: B1W2C4
LinkDB All DBs
Position
complement(2899700..2901286)
Genome map
AA seq 528 aa AA seqDB search
MSVTRHTPQARRRLAAATVIATAAAVALATAALPATAAERAPEGVILNAGAPGTISDSYI
VTLKDSAAKSDSAQGKALAKKYGASIERTYRSALNGYAVEATAAEAKKFAADPAVASVSQ
NRTFTVSATQTNPPSWGLDRIDQRSLPLDQRYTYPDKAGEGVTAYVIDTGVRISHSDFGG
RAANGYDAIDNDNVAQDGHGHGTHVAGTVAGTAHGVAKKAKIVGVRVLNNQGSGTTAQVV
AGIDWVTANAVKPAVANMSLGGGADAVLDAAVQRSIAAGITYAVAAGNESTNANTKSPAR
VAEAITVGSTTNTDARSSFSNFGAVVDIFAPGSSITSTWNTSDSATNTISGTSMASPHVA
GAAAIYLADNPASTPAQVSAGLVAASTPGVVTNPGTGSPNRLLYVGPGGTTPPPGKKFEN
TTGYAINDNATVEAPVTVTGVTGNAPAALSVPVNISHTYIGDLKIDLVAPDGSVYNLKAY
GSGGSSDNVVTTYTVNASSEVANGTWKLRVSDNASADTGRINSWALQF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgacgcgtcacaccccccaggcccgtcgaagactcgccgcggcgaccgtcata
gccaccgcggcagccgtcgcgctcgccaccgccgcgcttccggcgaccgcggccgagcgc
gcacccgaaggcgtgattctgaacgcgggcgccccgggcaccatcagcgacagctacatc
gtgacgctgaaggactcggccgcgaagtccgattccgcccagggcaaggccctcgcgaag
aagtacggcgcgagcatcgagcgcacctaccgctcggccctcaacggctacgcggtcgag
gcgacggccgccgaggcgaagaagttcgccgccgacccggccgtcgcgtccgtctcgcag
aaccgcacgttcacggtctccgccacccagaccaacccgccctcctggggcctcgaccgg
atcgaccagcggagcctgccgctggaccagcgctacacctaccccgacaaggccggcgag
ggcgtcaccgcctacgtcatcgacaccggggtgcgcatcagccacagcgacttcggcggc
cgggcggccaacggctacgacgccatcgacaacgacaacgtcgcgcaggacggccacggc
cacggcacacacgtggcgggcaccgtcgcgggcaccgcccacggcgtcgccaagaaggcg
aagatcgtcggcgtccgtgtcctgaacaaccagggctccggcaccaccgcgcaggtcgtc
gccggcatcgactgggtgacggccaacgccgtcaagcccgccgtcgccaacatgagcctc
ggcggtggcgccgacgcggtcctcgacgcggccgtccagcggtccatcgccgccggcatc
acctacgccgtcgcggcgggcaacgagtcgaccaacgcgaacaccaagtccccggcacgt
gtcgccgaggccatcacggtcggctcgacgaccaacaccgacgcccgctccagcttctcc
aacttcggcgcggtcgtggacatcttcgcgcccggttcctcgatcacctcgacgtggaac
accagcgacagcgccacgaacaccatctccggtacgtcgatggccagcccgcacgtcgcc
ggcgccgccgcgatctacctcgccgacaacccggcctcgacccccgcccaggtctccgcc
ggactggtcgcggcctccacccccggggtcgtcaccaacccgggcaccggctcgccgaac
cggctgctgtacgtcggtccgggcggcaccacaccgccccccggcaagaagttcgagaac
accaccgggtacgcgatcaacgacaacgccaccgtcgaggcgccggtcaccgtcaccggg
gtcaccggtaacgccccggccgcgctgagtgtcccggtcaacatctcgcacacctacatc
ggcgacctgaagatcgacctggtcgcgcccgacggttcggtctacaacctgaaggcgtac
ggctccggcggcagcagcgacaacgtggtcaccacgtacaccgtcaacgcctcgtccgag
gtcgccaacggcacctggaagctccgggtgagcgacaacgcgagcgccgacaccggccgg
atcaacagctgggcgctccagttctga

DBGET integrated database retrieval system