KEGG   Streptomyces griseus: SGR_2595Help
Entry
SGR_2595          CDS       T00691                                 

Definition
(GenBank) putative NRPS
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAG19424
Kitasato: SGR2595
UniProt: B1W2R0
LinkDB All DBs
Position
complement(3069318..3074603)
Genome map
AA seq 1761 aa AA seqDB search
MDLLDKTAPPTDLSVTAATTFVDVVTERAALSGGTAYTFVSPGRDERPSLTFPELDARAR
AVGAMLAGRGLTGERILVLLPPGLDYVVAFLGCLYAGAVAVPLYPPSGGKYSARHLAVLA
DSRPAAALVPGAEPARAAELAEELHAPGLQLLSVDGELPGAGDWRRPHIDGDSLAFLQYT
SGSTGTPRGVRVTHRNLVANSAQIQERFAAGPDTAVVSWLPPYHDMGLIGGILQPVYAGA
TATLLSPTAFITRPLLWLELISELGTTISGGPNFAYDLCVDRIPEERLAGLDLSRWQVAF
NGAEPVRASTLDRFAARMAPFGFRRDAFFPCYGLAEATLMVSGRRVAGEHVARTFRADTL
GPGRLPEPAPDGLPVVDCGPVAVDLDLTVADAERGEACAEGAVGEVWVAGENVADGYWGH
AAADGTFGARLPGDPRTYLRTGDYGFVRDGRLYVTGRSKDLIVVRGRNHYPQDLETTALA
AHDALRRGAAAFAVERDGREEICLVLETTHGHVPETADAVIGAVRSALVREHAVAAGTVV
LVRPGQIPRTTSGKIQRSAARAAFADATMKVVHRSDTGDGPLPAPTAPRPAALPGRGAPD
DTVRAVIADAATRRLGVTVDRSAPLVGQGLDSLAAVELQASVARAAGVELSLEQLLAGAS
IDGLTLDTPAAPAPRQPSAAPGDRLPLTTNQQAMVFLEQQHPGTSALHISLAVRLLTEID
TEALRRTFQRLVDRHAVLRTALRWADGEPYQSVLPRLDADFTVEDARTLDAAALAARLER
ACEGTPFALDEGRVMRALLLRRADGDILSLTLHHVAADMWSMALLTDELGRLYAQELGRG
PALPEPAEAAYLSLADRQRDLLESPRGERLWEYWKAELDGCEPVVELPADRPRPPVQNHR
GDTVTFSLDAGVTRELRRHAEAGDTTLFVALLSVFQLLVHRYTGEEDFLVGVPGSGRHEA
DLHDVIGYFVNPLLIRSRVTEEATFTERMRDTRRTVVGALAHQEMPFPALVQRMRLHRDA
SRSPGYQVMFSLTNPHLLGQDGLGALQTGKGGLRARVGELDVESVELIRRTSQVDLGMTL
SEAGDGLEGLISYSTDLFDRTTVDRFADHFAQLAAQVAAAPAEPLRLLPHASEAEQREAA
GWNETATDYPKHSNLRALFADQVRAAPDAPALVHGGFRRTYRELDRCSNALAAHLRKLGV
GPETLVGLYVDRDPAVVVAMLAVVKAGGAYLPLDPSHPERRLRQILDEARPALVLTPSAD
RVPPVGDGLPVVPVDPYLGADVAADPGHDTAVDGGAGPGSLLYVMYTSGSSGRPKGICIT
HRNVIRLVRDTNFIHIAPGDRMAQISNAAWDAATLEIWGALANGAELHGFDQATVLNPPV
LGEALRAAAVDTVVFATPLFTEVAAYDPTVFAGARELVVGGDTMDPKRAREVVELGGPLL
INDFGPTESTSIAATFAVRQVPDGTWRVPIGRPISNTQVHVLDAWLRPVPVGVPGQLFIG
GDGLGRGYLGRPELTAGAFLPDPFSDEPGARMYATGDKVRRLPDGMLDFLGRIDFQVKVR
GYRIELGDIDSAALSHPGVRESLTVVDESAGHKRLVAYYSGTPTPRELTGYLADWLPRYM
IPPVLIPLPELPKNPNRKIDRAALPKPPAGRAAAPDADTELTTLEREAVALLADVLGTPD
VRADDNFFEIGGHSLLAIRMTTRIRAQYGVEINLNAFFDDPTARGVARCVRELLDAGAAV
PPTAAAPGPVALDRTRYATRR
NT seq 5286 nt NT seq  +upstreamnt  +downstreamnt
atggacctgctggacaagacggccccgcccacggacctctcggtcaccgccgccacgacc
ttcgtggacgtcgtgaccgaacgcgccgcgctcagcggtggcaccgcctacaccttcgtg
agccccgggcgggacgagcggccctcgctgaccttcccggaactcgacgcccgggccagg
gcggtcggcgccatgctcgccggacgcggactcaccggcgagcggatcctggtcctgctc
ccgccgggcctcgactacgtggtggcgttcctcggctgcctgtacgcgggcgccgtcgcc
gtcccgctgtacccgccgagcggcggcaagtactccgcccggcacctggccgtcctcgcc
gactcgcggcccgccgccgcgctcgtccccggcgcggagccggcgcgcgccgccgaactc
gccgaggaactccacgcccccggactccagttgctgtccgtggacggcgaactgcccggc
gccggggactggcggcgtccgcacatcgacggggacagcctggcgttcctccagtacacc
tccggttccacgggtaccccgcgcggcgtccgggtcacccaccgcaacctggtggccaac
tcggcgcagatccaggagcggttcgcggcgggaccggacaccgccgtggtgagctggctg
ccgccgtaccacgacatgggcctgatcggcggcatcctccagcccgtctacgcgggagcg
acggccaccctgctcagcccgaccgccttcatcacccgcccgctcctgtggctcgaactg
atatccgagctgggcaccacgatcagcggtggtccgaacttcgcgtacgacctgtgcgtg
gaccgcatccccgaggagcggctcgccggactcgacctgtcgcggtggcaggtggcgttc
aacggcgctgagccggtccgggcgagcaccctcgaccggttcgccgcccgcatggcgccc
ttcggcttccgccgtgacgccttcttcccctgctacggcctcgccgaggcgaccctgatg
gtgtccggccggcgcgtcgccggtgagcacgtcgcccggaccttccgcgccgacaccctc
ggccccggccgtctccccgagcccgcgcccgacgggctgcccgtggtcgactgcgggccc
gtcgccgtggacctggacctcaccgtcgccgacgccgagcgcggcgaggcctgcgccgag
ggcgccgtcggcgaggtctgggtcgccggggagaacgtggcggacgggtactggggacac
gccgcggcggacggcaccttcggcgcccggctgcccggcgacccccgcacctacctgcgc
accggcgactacggcttcgtgcgcgacggccgcctgtacgtcaccggccgcagcaaggac
ctgatcgtggtccggggccgcaaccactacccgcaggacctggagaccacggccctcgcc
gcgcacgacgcgctgcgccggggcgccgccgccttcgccgtcgagagggacggccgcgag
gagatctgcctcgtcctggagacgacgcacggccacgtgccggagacggccgacgcggtc
atcggcgccgtccgctccgcgctcgtgcgggagcacgccgtggcggccggcaccgtggtg
ctcgtccggcccggccagatcccccgcaccaccagcggcaagatccagcggtccgcggcc
cgggcggccttcgccgacgccacgatgaaggtggtgcaccggtccgacaccggcgacggc
ccgctccccgccccgacggcaccccggccggccgccctcccggggcggggcgcgccggac
gacaccgtgcgcgccgtcatcgccgacgccgccacccgccgcctcggcgtcaccgtggac
cggtccgcgccactggtcggccagggactcgactcgctcgccgccgtcgaactccaggcc
tccgtcgcccgggcggccggcgtggagctgtcgctggagcagctgctcgcgggcgcgtcg
atcgacggactgaccctcgacacccccgccgcgccggccccgcggcagccctccgccgcc
cccggcgaccgcctgccgctgaccacgaaccagcaggccatggtcttcctggagcagcag
caccccggtacgtccgcgctgcacatctccctggccgtacggctgctgacggagatcgac
accgaagccctgcggcgcacgttccagcggctcgtggaccgccacgccgtgctgcgcacc
gccctccgctgggcggacggcgagccctaccagagcgtgctgccccggctcgacgccgac
ttcacggtggaggacgcccgcaccctcgacgccgcggccctcgccgcccgcctggaacgc
gcctgcgagggaacgccgttcgccctcgacgagggccgcgtgatgcgcgcgctcctgctg
cgccgcgccgacggcgacatcctctccctcaccctgcaccacgtcgccgccgacatgtgg
tcgatggcgctgctcaccgacgagctcggccgcctctacgcccaggagctcgggcggggc
ccggcgctgcccgagccggccgaggccgcttacctctcgctcgccgaccggcagcgggac
ctcctggaatcgccgcgcggcgagcggctgtgggagtactggaaggcagagctcgacggc
tgcgagccggtcgtcgagctgcccgccgaccggccgcgaccgccggtgcagaaccaccgc
ggcgacacggtgaccttctccctcgacgccggggtcacacgggagctgcggcgccacgcc
gaggccggggacaccaccctgttcgtcgccctcctctccgtcttccagctcctcgtgcac
cgctacacgggggaggaggacttcctcgtgggcgtgccgggctccggccggcacgaggcc
gacctccacgacgtcatcggctacttcgtgaacccgctgctcatccgctcccgggtcacc
gaggaggcgaccttcaccgagcggatgcgggacaccaggcgcacggtggtgggggcgctc
gcgcaccaggagatgcccttccccgctctcgtccagcggatgcggctgcaccgcgacgcc
tcccgctcgcccggctaccaggtcatgttcagcctcaccaacccccacctcctcggtcag
gacggcctcggcgcgctccagaccggcaaggggggcctgcgcgcccgggtcggcgagctg
gacgtggagtcggtcgaactgatccgcaggacgtcccaggtcgacctcgggatgacgctc
tccgaggcgggcgacggcctcgaaggcctgatcagctacagcaccgacctgttcgaccgt
acgacggtcgaccggttcgccgaccacttcgcccagctcgccgcccaggtcgcggcggcg
cccgccgaaccgctgaggctgctgccgcacgcctccgaggccgaacagcgcgaggccgcc
ggctggaacgagaccgcgaccgactacccgaagcacagcaacctccgcgccctcttcgcc
gaccaggtgcgggcggcgcccgacgcgcccgccctggtccacggcgggttccgccgcacc
taccgggagctcgaccgctgctccaacgccctggcggcccacctcaggaagctcggcgtc
ggcccggagacgctcgtcggcctgtacgtggaccgggaccccgccgtcgtcgtcgcgatg
ctcgccgtggtgaaggcgggcggcgcctacctgccgctcgacccctcccaccccgagcgg
cggctgcggcagatcctggacgaggcgcgcccggccctggtgctgaccccgtccgccgac
cgggtgcccccggtgggcgacgggctgccggtggtgcccgtcgacccgtacctgggcgcc
gacgtcgccgccgaccccggccacgacaccgcggtggacggcggcgccggtcccggatcg
ctgctctacgtgatgtacacctcgggctcgtcgggccgccccaagggcatctgcatcacc
caccgcaacgtgatccgcctggtgcgcgacaccaacttcatccacatcgcgccgggcgac
aggatggcgcagatctccaacgccgcgtgggacgcggccaccctggagatctggggcgcc
ctggccaacggcgccgagctgcacggcttcgaccaggccaccgtgctgaacccgccggtc
ctcggcgaggccctgcgcgccgccgccgtcgacaccgttgtcttcgccacaccgctgttc
accgaggtcgccgcgtacgacccgacggtgttcgcgggcgcccgggaactcgtcgtcggc
ggcgacacgatggaccccaagcgggccagggaggtcgtcgagctgggcgggccgctgctc
atcaacgacttcggcccgaccgagtcgaccagcatcgccgccaccttcgccgtccgccag
gtgccggacggcacctggcgggtaccgatcggccggcccatctccaacacccaggtccac
gtcctcgacgcgtggctgcgaccggtgcccgtgggcgtccccggccagctgttcatcggc
ggtgacgggctcggacgcggctacctcggccggccggaactgaccgcgggggcgttcctg
cccgacccgttcagcgacgagccgggagcgaggatgtacgcgaccggcgacaaggtgcgc
cggctgcccgacggcatgctcgacttcctcggacgcatcgacttccaggtcaaggtccgc
ggttaccggatcgagctgggcgacatcgattccgccgccctctcccacccgggcgtacgg
gagtcgctgaccgtggtggacgagagcgccgggcacaagcggctcgtcgcgtactactcg
ggcacgcccacgccgcgggagctgaccgggtacctcgccgactggctgccccggtacatg
attccgccggtcctgatcccgctgcccgagctgccgaagaacccgaaccgcaagatcgac
cgtgccgcgctgccgaagccgccggccggccgggccgcggccccggacgccgacacggag
ctgaccacgctggagcgcgaggcggtggcactcctcgccgatgtgctcggcacccccgac
gtacgggccgacgacaacttcttcgagatcggcggccactccctgctggccatccggatg
acgacgcggatccgggcccagtacggcgtggagatcaacctcaacgccttcttcgacgat
ccgaccgcccgcggcgtggcgcgctgcgtccgggaactcctcgacgccggagcggccgtg
cctccgacggcagccgcccccgggccggtggccctggaccggacccggtacgccacgcgc
cgctga

DBGET integrated database retrieval system