KEGG   Streptomyces griseus: SGR_3478Help
Entry
SGR_3478          CDS       T00691                                 

Definition
(GenBank) putative lysine biosynthesis enzyme LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
sgr  Streptomyces griseus
Pathway
sgr00300  Lysine biosynthesis
sgr01100  Metabolic pathways
sgr01210  2-Oxocarboxylic acid metabolism
sgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SGR_3478
Enzymes [BR:sgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     SGR_3478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 ATP-grasp ATPgrasp_ST Dala_Dala_lig_C Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: BAG20307
Kitasato: SGR3478
UniProt: B1VMJ7
LinkDB All DBs
Position
4076545..4077399
Genome map
AA seq 284 aa AA seqDB search
MGADHRVALVADRIAWEERLLIEAAPAFGLRIDWVNDESLSLGHPDAPSIKGYDALLVRS
RSYTRGGLIATLAEAAGVPTLNTARAIHACENKAALRALLRTAGVPVPDHRLVLSRKDFD
RALADLPLPLVLKPVFGGMGKRVTLIRHADTAHSVYDYVEDLAHAFEQASVVEPYLGGSS
VRCLVVGRELVGAAEFESGGSDWRNNAALGNKNRALAHDPDVVKIVDGVVDVLGPGIYGV
DLFATPDGHVVNEVNHAPGFRAVASATGADIPSAIGRYLQESLA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgaccaccgcgtcgccctcgtcgcggaccggatcgcctgggaggaacgcctg
ctcatcgaggcggccccggccttcggtctgcggatcgactgggtcaacgacgagtccctc
tccctgggccacccggacgccccgtcgatcaaggggtacgacgccctcctcgtccgcagc
cgcagctacacccggggcgggctgatcgccaccctcgccgaggccgccggggtccccacc
ctcaacaccgcccgggccatccacgcctgcgagaacaaggccgccctgcgcgccctgctc
cggaccgcgggcgtacccgtccccgaccaccggctcgtcctctcccgcaaggacttcgac
cgggcgctcgccgatctgccgctgcccctcgtcctcaaacccgtcttcggcgggatgggc
aagcgggtcacgctcatccggcacgccgacaccgcccactccgtctacgactacgtcgag
gacctggcccacgccttcgagcaggccagtgtggtggagccgtacctcggcggcagctcc
gtgcgctgcctggtcgtcgggcgggagctggtcggggccgccgagttcgagagcggcggc
agcgactggcgcaacaacgcggccctcggcaacaagaaccgcgccctcgcccacgacccg
gacgtcgtgaagatcgtcgacggtgtggtcgacgtcctcggacccgggatctacggggtc
gacctcttcgccacccccgacggccacgtcgtcaacgaggtcaaccacgcccccggcttc
cgggccgtcgcctcggccaccggagcggacatcccctcggccatcggccgctatctgcag
gagtcgctcgcatga

DBGET integrated database retrieval system