KEGG   Streptomyces griseus: SGR_4246
Entry
SGR_4246          CDS       T00691                                 

Gene name
griF
Definition
(GenBank) ortho-aminophenol oxidase
  KO
K20204  grixazone synthase / o-aminophenol oxidase [EC:1.10.3.15 1.10.3.4]
Organism
sgr  Streptomyces griseus
Pathway
sgr00380  Tryptophan metabolism
sgr00997  Biosynthesis of various secondary metabolites - part 3
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
Module
sgr_M00905  Grixazone biosynthesis, aspartate 4-semialdehyde => grixazone B
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SGR_4246 (griF)
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SGR_4246 (griF)
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.4  o-aminophenol oxidase
     SGR_4246 (griF)
    1.10.3.15  grixazone synthase
     SGR_4246 (griF)
SSDB
Motif
Pfam: Tyrosinase HAT
Other DBs
NCBI-ProteinID: BAG21075
Kitasato: SGR4246
UniProt: B1VTI5
LinkDB
Position
4966261..4967181
AA seq 306 aa
MVHVRKNHLTMTAEEKRRFVHAVLEIKRRGIYDRFVKLHIQINSTDYLDKETGKRLGHVN
PGFLPWHRQYLLKFEQALQKVDPRVTLPYWDWTTDHGENSPLWSDTFMGGNGRPGDRRVM
TGPFARRNGWKLNISVIPEGPEDPALNGNYTHDDRDYLVRDFGTLTPDLPTPQELEQTLD
LTVYDCPPWNHTSGGTPPYESFRNHLEGYTKFAWEPRLGKLHGAAHVWTGGHMMYIGSPN
DPVFFLNHCMIDRCWALWQARHPDVPHYLPTVPTQDVPDLNTPLGPWHTKTPADLLDHTR
FYTYDQ
NT seq 921 nt   +upstreamnt  +downstreamnt
atggtccacgtacgcaagaaccacctcaccatgacggccgaggagaaacgccggttcgtc
cacgcggtcctggagatcaagaggcgcggcatctacgaccggttcgtcaagctccacata
cagatcaactccacggactacctcgacaaggagaccggcaagcgcctcggccacgtcaac
ccggggttcctgccgtggcaccgccagtacctgctgaagttcgaacaggccctccagaag
gtcgacccgcgcgtcaccctgccctactgggactggaccaccgaccacggcgagaactca
ccgctctggtccgacacgttcatgggaggcaacggccggcccggcgaccgccgcgtcatg
accgggcccttcgcccgccgcaacggctggaagctcaacatcagcgtcatcccggaaggc
cccgaggatccggccctgaacggcaactacacccacgacgaccgcgactacctcgtacgg
gacttcggcacgctcaccccggacctgccgaccccgcaggagctggagcagaccctcgac
ctcaccgtctacgactgcccgccgtggaaccacacctccggcggcaccccgccgtacgag
agcttccgcaaccacctggagggctacaccaagttcgcctgggagccgaggctcggcaag
ctgcacggcgccgcgcacgtgtggaccggcggccacatgatgtacatcggctcgccgaac
gacccggtgttcttcctcaaccactgcatgatcgaccgctgctgggccctgtggcaggca
cgccacccggacgtgccccactacctgccgaccgtgccgacccaggacgtgcccgacctc
aacaccccgctcggaccctggcacaccaagacgcccgcggacctgctcgaccacacgcgg
ttctacacctacgaccagtag

DBGET integrated database retrieval system