KEGG   Streptomyces griseus: SGR_5177Help
Entry
SGR_5177          CDS       T00691                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAG22006
Kitasato: SGR5177
UniProt: B1VYM1
LinkDB All DBs
Position
6095001..6096461
Genome map
AA seq 486 aa AA seqDB search
MTELVEHGQLFIGGEFTDPLGTEVIEVISPHTEEVIGRVPHASEGDVDRAVAAARRAFDE
GPWPRMGLDERIAVITRIKDAFAVRHEEFARLISAQNGTPYSASVMVQALAAMMVWDSAI
TVARDFPYEERRDGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCTAVLKV
SPETPLDAYLLAELAEEAGLPPGVLSILPADREVSEYLVGHPDVDKVSFTGSVAAGRRVM
EVASRNLTRVTLELGGKSAAVILPDADLEAAVAGIVPFAWMINGQACVAQTRILAPNSRY
DEMAEAFAAAAGALRVGDPLDPTTELGPLVARRQQQRSLDYIRLGQEEGAKILTGGNRPA
ARERGWYVEPTLFGSVDNSMRIAREEIFGPVICLIPYEDEDEAVRIADDSPYGLSGSVWT
ADTERGIDVARRVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFFEHKMIHLP
AGYREA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcttgtggaacacggacaactgttcatcggcggggagttcaccgacccgctc
ggcaccgaggtcatcgaggtgatctccccgcacaccgaagaggtcatcggccgggtgccg
cacgcctccgagggcgatgtggaccgggcggtcgccgccgcccgccgcgccttcgacgag
gggccctggccgaggatgggcctggacgagcggatcgcggtgatcacccggatcaaggac
gccttcgccgtacgccacgaggagttcgcgcgcctgatcagcgcccagaacggcaccccg
tacagcgcgagcgtcatggtgcaggcgctggccgcgatgatggtctgggactcggcgatc
acggtggcgcgcgacttcccgtacgaggagcggcgcgacggcgtcctcggccccctgctg
gtccgccgcgagccggtcggggtggtcgccgcggtcgtcccgtggaacgtcccgcagttc
acggccgccgcgaaactggcccctgccctcctggcgggctgcacggcggtcctgaaggtc
tccccggaaacccccctggacgcctatctcctggcggagttggccgaggaggcggggctg
ccgcccggagtcctctccatcctcccggccgaccgcgaggtcagcgagtacctggtgggc
cacccggacgtggacaaggtctccttcaccggctcggtcgccgccggccgccgcgtcatg
gaggtggcctcccgcaacctcacccgcgtcaccctggagttgggcggcaagtccgccgcg
gtcatcctccccgacgccgacctggaagcggcggtcgcgggcatcgtccccttcgcctgg
atgatcaacggccaggcgtgcgtggcccagacgcgcatcctggccccgaactcccgctac
gacgagatggcggaggccttcgcggcggcggccggagccctgcgcgtgggcgaccccctc
gacccgacgaccgaactgggccccctggtggcccggcgccagcagcaacgctcgctggac
tacatccggttgggccaggaggagggcgccaagatcctcacgggcggcaaccgcccggcc
gcccgggaacgcggctggtacgtcgagccgaccctcttcggctccgtcgacaactccatg
cgcatcgcccgcgaggagatcttcggcccggtgatctgcctgatcccgtacgaggacgag
gacgaggccgtccgcatcgccgacgactccccgtacggcctcagcggcagcgtctggacg
gcggacacggaacgcggcatcgacgtggcccgccgggtccgcaccggcacctacagcgtg
aacacgttcagcctcgacatgctcggccccttcggcggctacaagaactccggcctgggc
cgtgagttcggccccgagggctacggcgagttcttcgagcacaagatgatccacctgccc
gccggctaccgggaggcgtga

DBGET integrated database retrieval system