KEGG   Streptomyces griseus: SGR_5921
Entry
SGR_5921          CDS       T00691                                 

Gene name
stsC
Definition
(GenBank) putative L-glutamine:scyllo-inosose aminotransferase
  KO
K05957  L-glutamine:scyllo-inosose aminotransferase [EC:2.6.1.50]
Organism
sgr  Streptomyces griseus
Pathway
sgr00521  Streptomycin biosynthesis
sgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_5921 (stsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgr01007]
    SGR_5921 (stsC)
Enzymes [BR:sgr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.50  glutamine---scyllo-inositol transaminase
     SGR_5921 (stsC)
Amino acid related enzymes [BR:sgr01007]
 Aminotransferase (transaminase)
  Others
   SGR_5921 (stsC)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-ProteinID: BAG22750
Kitasato: SGR5921
UniProt: B1W368
LinkDB
Position
complement(6928245..6929519)
AA seq 424 aa
MDSSLAISGGPRLSNREWPRWPQPGDRALKSLEDVLTSGRWTISCAYQGRDSYERQFASA
FADYCGSAMCVPISTGTASLAIALEACGVGAGDEVIVPGLSWVASASAVLGINAVPVLVD
VDPATYCLDPAATEAAITERTRAITVVHAYSAVADLDALLDIARRHGLPLIEDCAHAHGA
GFRGRPVGAHGAAGVFSMQGSKLLTCGEGGALVTDDADVALRAEHLRADGRVVRREPVGV
GEMELEETGRMMGSNACLSEFHAAVLLDQLELLDGQNARRTRAADHLTDRLSELGMTAQA
TAPGTTARAYYRYLVRLPDEVLAVAPVERFAHALTAELGFAVTQTHRPLNDNPLNRPSSR
RRFATDARYLERVDPSRFDLPAAKRAHESVVSFSHEVLLAPLDAIDDIARAFRKVLDNVR
EVSR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggatagttcactggcaatctctggtgggccacgtctgtccaaccgcgagtggccacgt
tggccacagccgggtgaccgcgcgctgaaaagcctcgaagacgtcctgacaagcgggcgt
tggaccattagctgcgcctatcagggccgggattcgtatgagcgtcaattcgcgtccgca
ttcgcggactactgcggctcggcgatgtgcgtgccgatatcgacgggaaccgcttcgctg
gccatcgccctggaggcctgcggggtcggcgccggcgacgaggtgatcgtccccggactg
agctgggtggcctccgcctcggccgttctcggcatcaacgccgtccccgtgctggtggac
gtcgacccggccacgtactgcctggacccggcggccaccgaggcggcgatcacggagcgg
acccgggccatcaccgtggtgcacgcctactcggccgtcgcggacctggacgcgctcctg
gacatcgcccggcggcacggcctgccgctgatcgaggactgcgcacacgcgcacggcgcc
gggttccgcggccgtccggtgggggcgcacggtgccgcgggagtcttcagcatgcagggc
agcaagctgctgacctgcggcgagggcggtgcgctggtgaccgacgacgcggacgtcgcg
ctccgtgcggagcacctgcgcgcggacggacgggtggtgcggcgcgagccggtgggcgtg
ggcgagatggagctggaggagaccggccggatgatgggcagcaacgcctgcctgtcggag
ttccacgcggcggtactgctggaccagctcgaactgctcgacgggcagaacgcccgccgg
acccgggcggccgaccacctcaccgaccggttgagcgagctggggatgacggcccaggcg
acggccccggggacgaccgcccgcgcctactaccgctatctggtgaggctgcccgacgaa
gtgctggccgtggcgccggtggaacggttcgcgcacgcgctcacggccgaactgggcttc
gcggtgacccagacccaccgtccgctgaacgacaacccgctgaaccgcccctcgtcgcgc
aggcggttcgccaccgacgcccgctacctggagcgggtggacccgtcccggttcgacctt
ccggccgccaagcgcgcccacgagagcgttgtgagcttcagccacgaagtgctcctggct
ccgctcgacgccatcgacgacatcgcccgggcgttccggaaggtcctggacaacgtccgg
gaggtttcccgctga

DBGET integrated database retrieval system