KEGG   Streptomyces griseus: SGR_5938
Entry
SGR_5938          CDS       T00691                                 

Gene name
strK
Definition
(GenBank) putative streptomycin-6-phosphate phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
sgr  Streptomyces griseus
Pathway
sgr00521  Streptomycin biosynthesis
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_5938 (strK)
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     SGR_5938 (strK)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Other DBs
NCBI-ProteinID: BAG22767
Kitasato: SGR5938
UniProt: B1W385
LinkDB
Position
6947343..6948692
AA seq 449 aa
MRFAYGRLPWRRGAVLGSALLVLVTAPAASTATERSGPAPARSVILLIGDGMGDAEITAA
RNYSVGAAGRLAMDTLDASGRRTTYAVDERGRPVYVTDSAAGATAWATGRRTVNGRVSKS
HDTDRPMPTLLELARDRGYATGSVTTASVADATPAALTAHVTDRSCKGPADMAACPADTR
AGGGEGSIAEQTVAARPDVLLGGGADHFAQTVTDGPFRGRTVTQQARAAGYQVVRDRTQL
AAARPGRPVLGLFAPEYVPVEWTGPPAAPGGTAPQRCATRNPGRPAGTPDLAESTRAALD
LLTARAHHRGAPGRGFFLQVEGASIDDRAHEADPCGQLGETLAFDRAVAAALDHAERHPR
TLVIVTADHGHATQILPHDARPAGLSATLVTDEGGVMQLGYGTALPGETQEHTGVPVPVA
ARGPLADRVRGVQDNTSLFGTVTAALGLR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaggttcgcgtacggacggctgccctggcgccgcggcgccgtcctgggctccgccctg
ctggtcctggtcaccgcacccgccgcctccaccgcgaccgagaggtccgggccggccccg
gcgcggagcgtcatcctgctgatcggtgacggcatgggcgacgcggagatcaccgccgca
cgcaactactccgtcggggcggccggcagactggccatggacaccctggacgcgtccggc
aggcgcaccacgtacgcggtcgacgagcggggcaggccggtctacgtcaccgactccgcg
gcgggcgccacggcctgggcgacgggccggcgcacggtgaacggacgggtctcgaagtcc
catgacaccgaccgcccgatgcccaccctgctggaactggcccgcgaccggggctatgcg
acgggcagcgtcaccacggcatcggtcgccgacgccacgcccgccgcgctgacggcgcac
gtcacggaccggtcctgcaagggaccggcggacatggccgcctgcccggcggacacccgg
gccggaggcggtgagggctccatcgcggagcagacggtcgccgcccggcccgatgtcctg
ctcggcggcggggccgaccacttcgcgcagaccgtcacggacggcccgttccgcggccgt
acggtcacgcagcaggcccgcgccgccggctaccaggtggtgcgcgaccgcacccagctg
gcggcggcccgccccggccgaccggtgctcgggctgttcgcacccgagtacgtgcccgtg
gagtggaccggccccccggccgcgcccggcgggaccgcgccccagcggtgcgccacccgc
aaccccggccggcctgcgggaacgcccgacctggccgagtccacccgggccgcgctggac
ctgctgacggcccgtgcccaccaccggggagccccgggcaggggcttcttcctccaggtc
gagggcgcgtcgatcgacgacagggcgcacgaggccgacccgtgcggccagctcggggag
accctggcgttcgaccgggccgtcgcggccgccctcgaccacgccgaacggcacccccgc
accctcgtgatcgtgaccgccgaccacggccacgcgacccagatactgccccacgacgcc
cgcccggcggggctgtccgccacgctcgtcaccgacgagggcggcgtgatgcagctcggc
tacggcaccgccctgcccggagagacgcaggagcacaccggggttccggtcccggtcgcc
gcccgcgggccgctcgcggaccgggtgcgcggagtccaggacaacacctcgctgttcggc
accgtgacagcggcgctcggactgcgctga

DBGET integrated database retrieval system