KEGG   Streptomyces griseus: SGR_6373Help
Entry
SGR_6373          CDS       T00691                                 

Gene name
pks3-1
Definition
(GenBank) putative type-I PKS
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Ketoacyl-synt_C PS-DH KR KAsynt_C_assoc PP-binding Thiolase_N adh_short Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: BAG23202
Kitasato: SGR6373
UniProt: B1W5P5
LinkDB All DBs
Position
complement(7611236..7619551)
Genome map
AA seq 2771 aa AA seqDB search
MNTFEHASSNAVAVVGLSCRLPGAPDTPSFWRLLSSGTSAITESSRFGDAVPVRWGGFLP
DDEVGAFDAEFFGISPKEAAAMDPQQRLLLELGWEALEDAGYVPAELRGEHLGVFVGSMA
SDYATIAARAGVVSRHSLTGLNRGLLANRLSYVLGLRGPSLAVDTGQSSSLVAVHLACQS
LRSGESEVALAAGVNLILTPQSTVEADRFGALSADGRSFTFDARANGYVRGEGGAVLVLK
GLAAARRDGDTVYAVIRGSAVNNDGPAATLTTPSRSAQEAVITAAHRRAGTAPDEVGYVE
LHGTGTPVGDPIEANALGATLGRGRTEPLRVGSVKTNIGHLEGAAGIAGLLKTVLSLHHG
AVPPSLNFATPNPDVPLEELNLSVQQELEEVGPTVAGVSSFGVGGTNCHVVLTGTERSPR
EPRPAAAGGPLPWVLSARTEQGLRDQAGRLYERVAAPDAPASDDIAFSLATSRTHFPYRA
AVLSGDAEGLLGLRDGGLSADLVRGRAVPSGGTVLVFPGQGSQWAGMAAELIATAPVFAA
KIHACAEVIDPLVGWSLVDVLREEPGSPSLERDDVVQPALFAVMVAFAALWQAAGVRPDA
VIGHSQGEMAAAHVAGALSLRDAATLVVRRAQQVVRIPRAGGLLSVPLPVAKVREDIAAW
PDRLGIGAVNGPSATIVSGELDALRELESAYVADGVKARVVPINYASHSPLVEDIREDVL
RAAADVEPLRTDVAFYSTVTGALLPDTSVLDAEYWYGNLRQAVEFERAVRAAFADGHTTF
VECSAHPVLGVGITQILEGREAVITGTLRRDRGGLRQFLSSLAGVHVGGGAVDWAAADWE
GLLAGRPVRRVALPSYAFQRERQWLDVAADGVVPSVPGPRPAPEQAPAGGGQRPGSGGDL
TPERALDLVRGAVAVVLGHASPASVPVDATFKELGLDSIGAVEFGRALAGATGRPTTSTL
TYDHPTPASVAAYLTRGDAEEEFTAAGASDEPIAIVSASGRWPGGADTPERLWQIAVDGV
DTVGPFPSNRGWDLEALYSPDEPRTGTSYTDRGAFLYGADEFDGAFFGLGPREATAMDPQ
QRLLLESAWEAVERAGIEPGSLRGSPTGVFIGVMPQEYGTRLHQTTEEYDGHALTGGLTA
VASGRLSYVLGLEGPAISVDTACSASLVSMHLAVQSLRRGECDLALAGGVTVMSTPGMFT
EFSRQRGLARDGRCKPFSDAADGTAWGEAAGVVMLERLSDAVRNGHPVLALVRGSAINQD
GASNGLTAPNGPSQERVIRASLADAGLRPSDVDAVEAHGTGTTLGDPIEAQALLATYGRE
RDVPLLLGSVKSNIGHTQAAAGVTGVIKMVHALRNGVLPATLHVDEVSRHVDWSPGTVSV
LTRNTPWPETGRPRRAAVSSFGISGTNAHLILEQAPKTAPASGAVEGAGAAEAAVSAVSA
EAVTGPAVVPWVLSAGSVAALREQAARLHERVLGDPGAGVEDIAASLTRTRSSFDHRAVV
VGAREQLLDGLLAVRDDEEESAAVVRGTVAPRGRTVFVFPGQGAQWAGMGRELLATSPVF
ARAIERCAESLAPHIDWSLTDVLRGEPDSASLERVDVVQPALWAMNVALAELWKSAGVRP
DAVIGHSQGEIAAAVVAGALSVEDGARTVALRSRAIKQIEGGGGMASVPLPADAVRERLT
RWGARLDVAAINGPSATIVSGDADALREMVDACRADGVSAKTIPVSYASHSSHVEAVRDD
LARALKDVEPRATGLTFFSTVTTRPLDTTLLNADYWYENLRETVRFEDTVRAALADGCTT
FVEISPHPVVAVGLNQITDEAVITGTLRRDKGGLDQFYAALARVHVTGVTVAWENVVSGR
TVELPTYPFQRRRFWLDAPATTGDVGAAGLEEAGHPLLGATVELAGDGGLVLTGRVSLGV
HRWLADHAVFGRPLLPGTGFLELALHAAGRVGAASVDELTLEAPLLLTEDGAAQIQVVAG
PADEDGQRTVGVYSREAGGEWTRNAHGTLATAPDGEPAVREERLSGTWPPPDATTVDVEE
LYDRLSAQGYDYGPAFRGLRAVWQRGEEIFAEVALDEDAPGAEEFGLHPALLDAMLHPVV
GIAVTGPQVRLPFSWNGVRLYAPGATELRVRISPAGQDAVTITAATEGGLPVAHVDSLRL
LPVSADQLGGARTTPPYRLTWSETAVTRAPEPAVAVTDIETGFAELADVPEFVVLDVASR
APGSVVAETHRVTARVTELLREWLADERFTASTLVLRTRHAVATGAPADADAVADLVAAP
VWGLVRTAQAEHPDRLVLLDADGDLDAGLLAGAVASGEAQFAIRDGAVLVPRLAQLTPGA
LAGAVPALDPEGTVLITGGTGGLGGLVAKHLVTRHAVRHLVLTSRRGADAPGARELADEL
VALGARVRLAACDAAEADDLAALLATVPPEHPLTAVVHTAGVIADGTVASLSAERVHSVL
RPKVDAAWNLHELTSGLDLSAFVLFSSAVGVVGNPGQANYGAANGFQDSLAHHRHAQGLP
AVSAAWGLWAEASGMTSHMTATDVERIGQRGLRPMPTEVGLAHFDAALSAGLPALVTARI
ETRDVDTGSIPVLKGLAGSGPKRNAPKRSLAAELVGLDAAQQHALLLDAVLRTAAGTLGH
DSADAITAHGGFLEQGFDSLSAVELRTRLGRLVDTKLPSTLTFDYPTPDAIAGHLRSLLV
RDGTESAPDVLGELDRLRALLSATDAEALEKDRVAVVAALNELMGLVDVEYAIDTQRSDE
DFFAMIDNELA
NT seq 8316 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccttcgagcacgcatccagcaatgccgtcgccgtcgtcggcctgtcgtgtcgc
ctgccgggcgcgccggacacgccgtcgttctggcggctgctgtcgtcgggcacgagcgcg
atcacggagtcctcccggttcggcgacgccgtcccggtgcgctggggcggcttcctcccg
gacgacgaggtgggcgccttcgacgcggagttcttcggcatctcgccgaaggaggcggcg
gcgatggacccgcagcagcggctgctgctcgaactcgggtgggaggcgctggaggacgcc
gggtacgtgccggccgagctgcgcggtgagcatctcggggtgttcgtggggtcgatggcc
tccgactacgcgacgatcgcggcgagggcgggtgtggtgtcgcggcactcgctgacgggc
ctcaaccgcggtctgctcgccaaccggctgtcgtacgtgctcggtctgcgcgggcccagc
ctcgccgtcgacacggggcagtcgtcgtcgctggtcgccgtgcacctggcgtgccagagc
ctgcgctccggcgagtccgaggtcgctctcgccgccggtgtcaacctgatcctcacgccg
cagagcacggtggaggccgaccggttcggggcgctcagcgccgacggccgcagcttcacc
ttcgacgcccgcgccaacggctacgtgcggggcgagggcggtgcggtgctggtcctcaag
gggctcgcagcggcgcgccgggacggtgacaccgtctacgcggtgatccgcggcagcgcg
gtcaacaacgacgggcccgcggcgacgctgaccacgccgagccggagcgcgcaggaggcg
gtcatcaccgcggcgcaccgccgcgccggcaccgcaccggacgaggtcggctacgtcgag
ctgcacggcacggggacgccggtcggcgatccgatcgaggcgaacgcgctcggcgcgacc
ctcggccgggggcggaccgagcccctgcgggtcggctcggtgaagacgaacatcggccat
ctggagggcgccgcgggcatcgcgggtctgctgaagacggtgctgtcgctgcaccacggc
gcggtgccgccgagcctgaacttcgcgacgccgaacccggacgtcccgctggaggagctg
aacctctccgtgcagcaggagctggaagaggtcgggccgaccgtcgcgggggtgtcgtcg
ttcggcgtcggcggcacgaactgccacgtggtgctcaccggcacggagcggagcccccgg
gagccgcgcccggccgccgcgggcggtccgctgccctgggtgctgtccgcccgcaccgaa
caggggctgcgcgaccaggcgggacgcctgtacgagcgggtcgccgcgccggacgcgccc
gcttccgacgacatcgcgttctcgctggccaccagccgtacgcacttcccgtaccgcgcc
gcggtgctctccggggacgccgaagggctgctcgggctgcgggacggcggcctgtcggcg
gatctggtgaggggcagggccgtcccgtcgggcggcaccgtgctggtcttccccggccag
ggttcgcagtgggcgggtatggcggccgaactcatcgccaccgcaccggtgttcgcggcg
aagatccacgcgtgcgccgaggtgatcgatccgctggtcgggtggtcgctggtcgacgtg
ttgcgggaggagccgggcagtccctcgctggagcgcgacgacgtggtgcagcccgcgctg
ttcgccgtcatggtcgcgttcgccgcgctgtggcaggcggcgggcgtgcggcccgacgcg
gtcatcggccactcgcagggcgagatggcggcggcgcacgtcgccggcgcgctgtcgttg
cgggacgccgcgacgctggtcgtgcgccgtgcccagcaggtggtgcgaattccgcgcgcg
ggcggtctgctgtccgttccgctgccggtcgcgaaggtccgtgaggacatcgcggcctgg
ccggaccgcctgggcatcggggccgtcaacgggccgtccgcgacgatcgtctccggtgag
ctcgacgcgttgcgggagttggagagcgcctacgtcgccgacggggtgaaggcccgtgtg
gtgccgatcaactacgcctcccactcgccgctggtcgaggacatccgcgaggacgtgctg
cgcgcggcggcggacgtcgagccgctccggacggacgtggcgttctactccacggtgacg
ggtgctctgctccccgacacctccgtcctggacgcggagtactggtacggcaatctgcgc
caggcggtcgagttcgagcgagcggtgcgcgccgccttcgccgacggtcacacgacgttc
gtggagtgcagtgcccacccggtgctgggggtcggcatcacccagatcctcgaaggccgg
gaagcggtgatcaccggtacgctccgccgcgaccggggcggtctgcgccagttcctgtcc
tccctggccggtgtccacgtgggcggcggcgcggtggactgggcggcggcggactgggag
ggcctgctcgccggccgtccggtgcgccgtgtcgccctgccctcctacgccttccagcgc
gaacgccagtggctggatgtggcggccgacggcgtcgtgccctccgtgcccggcccgcgg
cccgcgccggagcaggcgcccgccggcggaggtcagcggcccgggtccggcggcgatctg
acgcccgagcgcgcactcgacctggtgcggggcgcggtcgcggtcgtgctgggccacgcc
tcccccgcgtcggtgcccgtggacgcgacgttcaaggagctgggcctcgactcgatcggc
gcggtggagttcggccgggcgctcgccggtgcgaccgggcggccgacaacgtcgacgctc
acctacgaccatccgacgcccgcctcggtggccgcgtacctcacgcgcggcgacgccgag
gaggagttcaccgcggccggggcgtcggacgagcccatcgcgatcgtgtcggcctccggc
cgctggccgggtggcgcggacacgccggagcggctgtggcagatcgccgtcgacggtgtc
gacacggtcggtcccttcccgtccaaccggggctgggacctggaggcgctgtactcaccc
gacgagccgaggaccggcacctcgtacacggaccggggcgccttcctgtacggggcggac
gagttcgacggcgcgttcttcgggctggggccgcgcgaggccaccgcgatggacccgcag
cagcggctgctgctggagtcggcgtgggaggcggtggagcgggcgggcatcgagccgggt
tcgctgcgcggcagcccgacgggcgtgttcatcggtgtgatgccgcaggagtacgggacg
cggctgcaccaaacgacggaggagtacgacgggcacgcgctgaccggtggtctcaccgcg
gtcgcgtccggccgcctgtcctatgtgctgggtctcgagggccccgcgatcagcgtcgac
accgcgtgctcggcctcgctggtgtcgatgcacctggcggtgcagtcgctgcggcgcggc
gagtgcgacctggcgctggccggtggtgtgacggtcatgtcgacgcccggcatgttcacc
gagttctcccggcagcgcgggctggcgcgcgacggccgctgcaagccgttctcggacgcc
gccgacggcaccgcgtggggcgaggcggcgggcgtcgtgatgctggagcggctgtcggac
gccgtccgcaacgggcaccccgtgctcgcgctggtgcgcggttcggcgatcaaccaggac
ggtgcgtccaatggtctcaccgccccgaacggcccgtcgcaggagcgggtgatccgtgcc
tcgctggccgacgcggggctgcgtccatcggacgtggacgcggtcgaggcgcacggcacc
gggacgacgctgggcgaccccatcgaggcgcaggcgctcctcgcgacgtacggccgggag
cgtgacgttccgctgctgctcggttcggtgaagtcgaacatcggtcacacgcaggcggcg
gcgggcgtcaccggcgtgatcaagatggtgcacgcgctgcggaacggcgtgctgccggcg
acgctgcacgtggacgaggtgtcccggcacgtcgactggtcgccgggcaccgtctcggtg
ctgacccggaacacgccgtggcccgaaaccggccggccgcgccgggccgccgtgtcgtcg
ttcggcatcagcggcacgaacgcgcacctgatcctggagcaggcgccaaagaccgccccg
gcctccggcgcggtggagggcgcgggagccgcggaagccgcggtatccgcggtatccgcg
gaggcggtgaccggcccggcggtggtgccctgggtgctgtcggccgggtccgttgccgcg
ctgcgcgagcaggccgcacggctgcacgagcgggtcctcggcgaccccggtgcgggcgtc
gaggacatcgcggcctcgctcacccgtacccgctcctcgttcgaccaccgcgcggtggtc
gtgggcgcccgcgagcagctcctcgacggactgctcgcggtgcgcgacgacgaggaggag
tccgccgccgtcgtgcgcggcacggtggccccgcgcggccggaccgtcttcgtcttcccc
ggccagggcgcccagtgggccggaatggggcgtgaactcctcgccacctcaccggtgttc
gcgcgggcgatcgagcggtgcgcggagagtctcgcgccgcacatcgactggtcgctgacc
gatgtgttgcgcggcgagccggacagtgcgtcgctggagcgcgtcgatgtggtgcagccg
gcgctgtgggcgatgaacgtggccctggccgagctgtggaagtccgccggcgtgcggccc
gacgccgtgatcggccactcccagggcgagatcgccgccgccgtggtggccggggcactg
tccgtcgaggacggtgcgaggacggtcgcgctgcggagccgggcgatcaagcagatcgag
ggcggcggcgggatggcctccgtgccgctgcccgccgacgccgtgcgggagcggctcacg
cgctggggagcacggctcgacgtcgccgcgatcaacggcccgtcggccacgatcgtctcc
ggtgacgcggacgcgctgcgcgagatggtcgacgcctgccgcgccgatggcgtgagcgcg
aagacgatcccggtgagctacgcctcgcactcctcgcacgtcgaggccgtgcgcgacgat
ctcgcccgggcgctcaaggacgtcgaaccgcgggccaccggcctgacgttcttctcgaca
gtcacgacacggccgctcgacacgacgctgctgaacgccgactactggtacgagaacctg
cgcgagaccgtgcggttcgaggacaccgtgcgggcggcgctcgcggacggctgcacgacg
ttcgtcgagatcagcccgcaccccgtggtggcggtcgggctcaaccagatcaccgacgaa
gcggtgatcaccgggacgctgcggcgcgacaagggcggcctggaccagttctacgccgcc
ctcgcccgcgtccatgtcaccggggtgacggtcgcgtgggagaacgtcgtctccggccgc
accgtcgagctgccgacgtacccgttccagcgcaggcggttctggctcgacgcaccggcg
acgaccggtgacgtcggcgcggcggggctggaggaggccgggcacccgctgctcggcgcg
accgtggagctggccggcgacggtgggctcgtgctgaccgggcgggtgtcgctgggcgtg
caccggtggctcgcggaccacgcggtgttcggccggccgctgctgcccggcaccgggttc
ctggagctggcgctgcacgcggcgggccgggtgggcgccgcgtcggtggacgagctgacg
ctggaggcgccgctgctcctcaccgaggacggcgccgcgcagatccaggtcgtggccggt
ccggcggacgaggacggccagcgcaccgtcggcgtgtactcgcgcgaggccggcggtgag
tggacgcgcaacgcccacggcacgctcgcgaccgcgccggacggggaaccggccgtgcgc
gaggagcggctgtcgggcacgtggccgcccccggacgccacgacggtggacgtcgaggag
ctgtacgaccggctttcggcccaggggtacgactacgggcccgcgttccgcggtctgcgt
gcggtgtggcagcggggcgaggagatcttcgccgaggtggctctggacgaagacgctccc
ggggccgaggagttcggtctgcatccggcgctgctggacgcgatgctgcacccggtggtg
ggcatcgcggtcaccggaccgcaggtgcggctgccgttctcgtggaacggggtgcggctg
tacgctccgggcgccacggagctgcgggtgcggatctcgccggccggccaggacgcggtc
acgatcaccgcggccaccgagggcggtctgccggtggcgcacgtggactcgctgcgcctg
ctgccggtctcggccgatcagctgggcggggcgcgcacgacacctccgtaccggctgacc
tggtccgagacggcggtcacgcgggcccccgagcccgcggtcgccgtcacggacatcgag
acgggtttcgcggagctggccgacgtgccggagttcgtggtcctggacgtggcctcgcgg
gcgccgggctccgtggtggcggagacgcaccgtgtcaccgcacgcgtcacggagctgctg
cgggagtggctggccgacgagcggttcaccgcgtcgacactggtcctgcgcacgcgccac
gcggtcgcgaccggcgcacccgccgacgccgacgcggtcgcggacctcgtggccgccccg
gtgtgggggctggtccgcaccgcacaggcggagcatccggaccgtctggtgctgctggac
gcggacggcgacctcgacgccggtctcctggcgggcgccgtcgcgagcggcgaggcccag
ttcgcgatccgcgacggcgcggtgctcgtaccgaggctggcacagctgacgccgggggcc
ctcgccggggcggtgccggccctcgaccccgagggcacggtgctgatcaccgggggaacc
ggtgggctgggcggactcgtggcgaagcacctggtgacacggcacgccgtacggcacctg
gtgctgacgagccgtcggggcgccgatgcgccgggggcgcgggagctggccgatgaactc
gtcgcgctgggtgcgcgggtgcggctcgcggcctgcgacgcggccgaggccgacgacctg
gccgcgctgctggcgaccgtcccgccggagcacccgctgacggccgtggtgcacacggcg
ggggtgatcgcggacggcacggtggcctcgctctccgcggagcgggtgcactcggtgctg
cgtccgaaggtcgacgccgcgtggaacttgcacgagctgacctcggggctggacctgtcg
gcgttcgtgctgttctcctccgccgtgggcgtggtcggcaacccgggccaggccaactac
ggggcggcgaacggcttccaggactccctggcacaccaccgccatgcgcagggcctgccc
gcggtgtcggccgcgtggggtctgtgggcggaggccagcggcatgacgtcgcacatgacc
gcgaccgacgtggagcgcatcgggcagcgcgggctcaggcccatgccgacggaggtgggt
ctcgcccacttcgacgcggcactctccgcggggctgcccgcactcgtcacggcccgcatc
gaaacgcgggacgtggacacgggctcgatccccgtgctcaaggggctcgccgggtccggg
ccgaagcggaacgcgccgaagcggtcgctggcggcggagctcgtcggactggacgcggcc
cagcagcacgcgctcctgctcgacgcggtgctcaggaccgcggccggcacgctcggccac
gactcggcggacgcgatcaccgcgcacggcgggttcctggagcaggggttcgactcgctg
agcgcggtcgagctgcggacccggctcggcaggctcgtggacacgaagctgccgagcacg
ctcaccttcgactatccgacgccggacgccatcgcgggccatctgcggtcgctgctggtg
cgggacgggaccgagtcggccccggacgtgctgggcgagctggaccggctgcgggccctg
ctgtcggcgacggacgccgaggcgctcgagaaggaccgggtggccgtggtcgcggccctg
aacgaactgatggggctggtggacgtcgagtacgcgatcgacacccagcgttccgacgaa
gacttcttcgcaatgatcgacaacgagctggcctga

DBGET integrated database retrieval system