KEGG   Streptomyces griseochromogenes: AVL59_02725Help
Entry
AVL59_02725       CDS       T04729                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sgs  Streptomyces griseochromogenes
Pathway
sgs00250  Alanine, aspartate and glutamate metabolism
sgs00410  beta-Alanine metabolism
sgs00430  Taurine and hypotaurine metabolism
sgs00650  Butanoate metabolism
sgs01100  Metabolic pathways
sgs01110  Biosynthesis of secondary metabolites
sgs01120  Microbial metabolism in diverse environments
sgs02024  Quorum sensing
Module
sgs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AVL59_02725
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AVL59_02725
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AVL59_02725
   00430 Taurine and hypotaurine metabolism
    AVL59_02725
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AVL59_02725
Enzymes [BR:sgs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AVL59_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANP48625
UniProt: A0A1B1AQ13
LinkDB All DBs
Position
complement(581995..583401)
Genome map
AA seq 468 aa AA seqDB search
MALHKGPEKHDERPVSVNPFFGEANPVVEMTEAPPKHRLPDAPLPPTTAAQIVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAILADLWNAPDP
SAAVGCSTTGSSEACMLAGMALKRRWAKRNADRYPGARPNLIMGINVQVCWEKFCNFWEV
EARLVPMEGDRYHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALDALQERTG
LDVPVHVDGASGAMVAPFLDEELVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDKEAL
PEELVFRVNYLGGDMPTFALNFSRPGSQVVAQYYTFLRLGREGYRAVQQSTRDTARYVAG
RIGALDDFRLLTHGDELPVFAFTTAADVTSYDVFDVSRRLRENGWLVPAYTFPANREDLS
VIRIVCRNGFSHDLADLFLDDLTRLVPELRRQPHPLTRDKEAATGFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcacaaaggtcccgagaaacacgacgagcggccggtgtcggtcaacccgttc
ttcggggaggcgaacccggtggtcgaaatgaccgaggccccgcccaagcaccggctcccc
gatgcgcccctgcctcccaccacggcggcgcagatcgtgcacgacgagctgatgctggac
ggcaactcccggctgaacctggcgaccttcgtcaccacctggatggagccgcaggccggg
gtgctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgagctggagcggcgctgtgtggcgatcctcgccgacctgtggaacgcgccggacccg
tcggccgccgtgggctgttcgaccacggggtccagcgaggcgtgcatgctcgccgggatg
gcgctgaagcggcgctgggcgaagcgcaacgccgaccgctacccgggcgcccgcccgaac
ctgatcatgggcatcaacgtgcaggtctgctgggagaagttctgcaacttctgggaggtg
gaggcccgcctggtccccatggagggcgaccggtaccacctcgacccgcaggcggcggcc
gagctgtgcgacgagaacaccatcggggtcgtcggcatcctcggctccaccttcgacggg
tcctacgagccgatcgcggacctgtgcgcggccctggacgcccttcaggagcgcaccggc
ctggacgtcccggtgcatgtggacggcgcgtccggggccatggtggcgcccttcctggac
gaggagctggtgtgggacttccgcctcccgcgcgtggcctcgatcaacacctcgggccac
aagtacggcctggtctacccgggcgtcggctgggccctgtggcgggacaaggaggcgctg
cccgaggaactggtcttccgggtgaactatctgggcggcgacatgccgaccttcgcgctc
aacttctcccgccccggctcccaggtggtggcgcagtactacacgttcctgcggctgggc
cgggagggctaccgggcggtgcagcagtcgacacgggacacggcgcggtacgtcgccggc
aggatcggggcgctggacgacttccggctgctcacacacggcgacgagctgccggtgttc
gccttcaccaccgccgcggacgtgacgtcgtacgacgtcttcgacgtctcccggcggctg
cgcgagaacggctggctggtgcccgcgtacaccttcccggccaaccgggaggatctctcc
gtgatccggatcgtgtgccgcaacggcttctcgcacgacctcgcggacctgttcctggac
gacctgacccgtctggtgcccgagcttcgccggcagccgcaccccctgacccgggacaag
gaggcggccaccggcttccaccactag

DBGET integrated database retrieval system