KEGG   Streptomyces griseochromogenes: AVL59_09400Help
Entry
AVL59_09400       CDS       T04729                                 

Definition
(GenBank) peptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
sgs  Streptomyces griseochromogenes
Brite
KEGG Orthology (KO) [BR:sgs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AVL59_09400
Enzymes [BR:sgs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AVL59_09400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ANP49796
UniProt: A0A1B1AT94
LinkDB All DBs
Position
complement(2044074..2045231)
Genome map
AA seq 385 aa AA seqDB search
MRPRSRGTVLAAALALALAAGPLVAPAFAAPDRTATGTTSGTATGTTTGPDAKALAAAIA
GLPDHDATAAALRVGGKGTWRGTAGVRDVRSGAPVLENGRFRAGSVTKVVTAAVVLQLAA
EGRIDLDGTVQRYLPGLLTDAFRPITVRQLLNYTSGLRPGASLGDTVEDGYPHRFETLTP
QQVVASSVAQGPAYEPGTHQEYDNIHYTVLGMLIEKVTGDSYAHQAAVRIFRPLGMRDSS
FPVGADPRIHGPHNRGYDWIDGKLVDVTEWNMSDRWAAGDLISTTADLEKLLVGLFRGRV
VPEPQLKEMFTLPDVPGARYGAALERFELNGKVIWGKTGSRPGYATVMAATPDLSRTLVY
SVDATDAKGDGQAIAERFAYPAFKR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccacgcagccgcggcaccgtcctcgccgccgccctcgcgctggccctggcggcc
ggcccgctggtggcccccgccttcgccgcgcccgaccggacggcgaccggcacgacgagc
ggcacggcgaccggcacgacgaccggtccggacgccaaagccctggccgcggcgatcgcc
gggctgcccgaccacgacgccaccgccgcggccctccgcgtcggcggcaaggggacgtgg
cgtgggacggccggagtgcgggacgtccggtccggggcgccggtgctggagaacggacgc
ttccgggccggttcggtgacgaaggtggtcaccgcggcggtcgtgctgcagctggccgcc
gagggccgcatcgacctcgacggcactgtgcagcggtatctgccgggcctgctcaccgac
gccttccgcccgatcaccgtgaggcagttgctgaactacaccagcggtctgcggccgggt
gcgtccctcggggacacggtcgaggacgggtacccgcaccgcttcgagacgctgacgccc
cagcaggtcgtggcgtcctccgtcgcccagggtccggcgtacgagccgggcacccaccag
gagtacgacaacattcactacaccgtgctcggcatgctcatagagaaggtgaccggcgac
tcgtacgcccaccaggccgcggtgcggatcttccggccgctcggcatgcgggacagctcg
ttccccgtcggagccgacccgcgtatccacggaccgcacaaccgtggctacgactggatc
gacggcaagctggtggatgtgaccgagtggaacatgtccgaccggtgggcggccggcgac
ctgatctccacgaccgccgacctggagaagctgctggtggggctgttccgcggccgggtg
gtgcccgagccgcagctgaaggagatgttcacgcttcccgacgtgcccggcgcgcgctac
ggcgcggcgctggagcggttcgagctgaacggcaaggtgatctggggcaagaccggctca
cggcccggctacgccacggtgatggccgccacccccgacctctcccgcaccctggtctac
tcggtcgacgcgaccgacgccaagggcgacggccaggccatagccgagcgtttcgcgtac
cccgcgttcaagcgctga

DBGET integrated database retrieval system