Streptomyces griseochromogenes: AVL59_12845 Help Entry AVL59_12845       CDS       T04729                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sgs  Streptomyces griseochromogenes Pathway sgs00362   Benzoate degradation sgs00621   Dioxin degradation sgs00622   Xylene degradation sgs01100   Metabolic pathways sgs01120   Microbial metabolism in diverse environments sgs01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sgs00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AVL59_12845    00622 Xylene degradation     AVL59_12845    00621 Dioxin degradation     AVL59_12845 Enzymes [BR:sgs01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      AVL59_12845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  ANP50387 UniProt:  A0A1B1AV19 LinkDB All DBs Position 3026550..3026732 Genome browser AA seq 60 aa AA seqDB search MPIVTIQQGPRDTELKRDLVKRVTDAFVDAYRIPAESVQVWIHEVEADSWGAAGKLVADK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt gtgccgatcgtcaccatccagcagggccctcgcgacaccgagctgaagcgggacctcgtc aagcgggtcaccgacgccttcgtggacgcgtaccggatcccggcggagagcgtgcaggtg tggatccacgaggtggaggcggacagctggggcgccgccgggaagctcgtggccgacaag tag

DBGET integrated database retrieval system