KEGG   Streptomyces griseochromogenes: AVL59_13605Help
Entry
AVL59_13605       CDS       T04729                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sgs  Streptomyces griseochromogenes
Pathway
sgs00250  Alanine, aspartate and glutamate metabolism
sgs00410  beta-Alanine metabolism
sgs00640  Propanoate metabolism
sgs00650  Butanoate metabolism
sgs01100  Metabolic pathways
sgs01120  Microbial metabolism in diverse environments
Module
sgs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AVL59_13605
   00650 Butanoate metabolism
    AVL59_13605
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AVL59_13605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AVL59_13605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgs01007]
    AVL59_13605
Enzymes [BR:sgs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AVL59_13605
Amino acid related enzymes [BR:sgs01007]
 Aminotransferase (transaminase)
  Class III
   AVL59_13605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANP50519
UniProt: A0A1B1AVA2
LinkDB All DBs
Position
3187736..3189019
Genome map
AA seq 427 aa AA seqDB search
MNDLYSRHRGVLPDWLALYYDEPLEITHGEGRHVWDSAGNKYLDFFGGILTTMTAHALPE
VTKAVTEQAGRIIHSSTLYLNRPMVELAERIAQVSGIPDARVFFTTSGTEANDTALLLAT
TYRRSNTVLAMRNSYHGRSFSTVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYTELDDR
AFIDACVADLKDILGHTRPPAALIAEPIQGVGGFTSPPDGLYAAFRDVLNAHGILWIADE
VQTGWGRTGEHLWGWQAHAQSGPPDIVTFAKGIGNGMSIGGVIARADVMNCLDANSISTF
GGTQITMAAGLANLNYLLEHDLQGNARRVGGLLIERLRAVTAQLPGVREVRGRGLMIGIE
LVRPGTDEADPQAAAAILEAAREGGLLIGKGGGHNTSALRIAPPLSLTVAEAEEGAAILE
RALRSTF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctactcccgccaccgcggtgtcctgcccgactggctcgccctctactac
gacgagccgctggagatcacccatggcgagggccgccacgtctgggactccgcaggcaac
aagtacctggacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgcccgag
gtgaccaaggcggtcaccgagcaggcggggcggatcatccactcctcgaccctctacctc
aaccggccgatggtcgaactcgccgagcgcatcgcccaggtgagcggcatcccggacgcc
cgggtcttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctcgccacc
acctaccggcgcagcaacacggtcctggccatgcgcaacagctaccacggccgctccttc
agcaccgtcggcatcaccggcaaccgcggctggtccccgacctcgctgtccccgctgcag
accctgtacgtccacggcggcgtccgcacccgcggcccgtacaccgagctggacgaccgc
gcgttcatcgacgcctgtgtcgcggacctgaaggacatcctcggccacactcgtccgccg
gccgcgctgatcgccgaacccatccagggcgtgggcggcttcacctccccgccggacgga
ctgtacgcggcgttccgcgacgtgctgaacgcccacgggatcctgtggatcgccgacgag
gtacagaccggctggggccgcaccggcgagcacctctggggctggcaggcgcatgcccaa
agcggcccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggggtgatcgcccgcgcggacgtcatgaactgcctggacgccaacagcatctcgacgttc
ggcggcacccagatcaccatggccgcgggcctcgccaacctcaactacctcctcgaacac
gacctccagggcaacgcccggcgcgtcggaggcctgctcatcgaacggctgcgggccgtc
accgcccagctgcccggcgtacgggaggtgcgcggccgcggcctgatgatcggcatcgag
ctggtcaggccggggacggacgaggccgatccgcaggcggccgccgcgatcctggaggcg
gcccgcgagggcggcctgctcatcggcaagggcggcggccacaacaccagcgccctgcgc
atcgccccgccgctgtcgctgaccgtcgcggaggccgaggagggcgcggcgatcctggaa
cgcgcgctgcggagcacgttctag

DBGET integrated database retrieval system