KEGG   Streptomyces griseochromogenes: AVL59_14855Help
Entry
AVL59_14855       CDS       T04729                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sgs  Streptomyces griseochromogenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANP50735
UniProt: A0A1B1AW09
LinkDB All DBs
Position
complement(3474459..3475538)
Genome map
AA seq 359 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMHYEAKWDGFRAIVFRDGDEIELGSRTGKPLTRYFPE
LVVALKERVPERCVLDGEIVIAREGRLDFDALTERIHPADSRVRMLAERTPASFVAFDLL
ALDDHSLLDVPLTDRRALLDRALSGVSAPVHLAPATTDVEMAQRWFEQYEGAGLDGVVAK
PLTGRYLQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDRGALQHVGVSAA
FPMKRRAELVEELEPLRMDDATGHPWAAWGDEAAHETARLPGAPSRWSGKKDLSWVPLKP
ERVAEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGAGEGTP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatc
ccgccgggcatgcactacgaggcgaagtgggacggtttccgggcgatcgtgttccgggac
ggggacgagatcgagctgggcagccgtaccggaaagccgctgaccaggtatttcccggag
ctggtcgtggcgctcaaggaacgggtgcccgagcggtgcgtgctggacggggagatcgtg
atcgcgcgggaggggcggctggacttcgacgcgctgaccgagcggatccatccggcggac
tcgcgggtgcggatgctggccgagaggaccccggcgtccttcgtcgctttcgacctgctg
gcgctggacgaccactccctgctcgatgtgccgctgaccgaccggcgggcactgttggac
cgggctctttcaggtgtgagcgctccggtgcatctggcgccggcgaccaccgacgtggag
atggcgcagcggtggttcgagcagtacgaaggggccgggctggacggggtcgtggccaag
ccgctcaccgggcgctatctgcaggacgagcgggcgatgttcaagatcaagcacgagcgg
acggcggatgtcgtcgtggcgggttaccgcttccacaagagcggcccggtggtgggttcg
ctgctgctggggctgtacgacgaccggggcgccctccagcatgtgggcgtgtcggccgcg
ttccccatgaaacggcgcgccgagctggtcgaggagctggagccgctgcgcatggacgac
gcgaccgggcatccgtgggcggcctggggggacgaagcggctcatgagacggctcggctg
ccgggggcgccgagccgctggtcgggcaagaaggacctgtcctgggtgccgttgaagccg
gagcgggtcgcggaggtggcctacgaccacatggagaacggcgcccgcttccggcacacg
gcccgcttccgccgctggcgtccggaccgcaccccggagagctgcacctacgcccagctg
gaggagcccgtgcgctacgacctcgcggagatcctgggagccggggaaggcactccttag

DBGET integrated database retrieval system