KEGG   Streptomyces griseochromogenes: AVL59_35840Help
Entry
AVL59_35840       CDS       T04729                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sgs  Streptomyces griseochromogenes
Pathway
sgs00061  Fatty acid biosynthesis
sgs00780  Biotin metabolism
sgs01100  Metabolic pathways
sgs01130  Biosynthesis of antibiotics
sgs01212  Fatty acid metabolism
Module
sgs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sgs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AVL59_35840
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AVL59_35840
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AVL59_35840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sgs01004]
    AVL59_35840
Enzymes [BR:sgs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AVL59_35840
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AVL59_35840
Lipid biosynthesis proteins [BR:sgs01004]
 Fatty acid synthase
  Component type
   AVL59_35840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ANP54234
UniProt: A0A1B1B5Y6
LinkDB All DBs
Position
complement(8276753..8277520)
Genome map
AA seq 255 aa AA seqDB search
MSGILEGKRILITGVLMESSIAFHVAKLAQEQGAEIILTAFPRPTLTERIAKKLPKPAKV
IELDVTNDEHLARLADVVGEELGGLDGIVHSIGFAPQDALGGNFLNTPFESVSTAMHVSA
FSLKSLTMACLPLMQNGGSVVGLTFDASFAWPQYDWMGPAKAALEATSRYMARDLGKQNI
RCNLVSAGPIGSMAAKSIPGFAELASVWDTRSPLEWDLKDPEPAGRGVVALLSDWFPKTT
GEIVHVDGGLHAIGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaatcctcgagggcaagcgcatcctgatcacgggtgtgctgatggagtcctcc
atcgccttccacgtcgccaagctcgcccaggagcagggcgccgagatcatcctgaccgcc
ttcccgcggcccacgctgaccgagcgcatcgccaagaagctgccgaagccggccaaggtc
atcgagctggacgtcaccaacgacgagcacctggcccggctggccgacgtcgtcggcgag
gagctgggcggcctcgacggcatcgtccactccatcggcttcgccccgcaggacgcgctc
ggcggcaacttcctgaacacgccgttcgagtcggtctccaccgccatgcacgtctcggcg
ttctccctgaagtcgctcaccatggcctgcctgccgctgatgcagaacggcggctcggtc
gtcggcctcaccttcgacgcctcgttcgcctggccgcagtacgactggatgggcccggcc
aaggccgccctggaggccaccagccgctacatggcgcgcgacctcggcaagcagaacatc
cgctgcaacctggtctcggcgggcccgatcggctccatggccgccaagtccatcccgggc
ttcgcggagctggcgtccgtgtgggacacccgctccccgctggagtgggacctgaaggac
ccggagccggccggccgcggtgtcgtcgccctgctgagcgactggttcccgaagaccacc
ggcgagatcgtccacgtcgacggcggtctgcacgccatcggcgcgtga

DBGET integrated database retrieval system