KEGG   Streptomyces griseochromogenes: AVL59_36310Help
Entry
AVL59_36310       CDS       T04729                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
sgs  Streptomyces griseochromogenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ANP54319
UniProt: A0A1B1B691
LinkDB All DBs
Position
8374590..8375579
Genome map
AA seq 329 aa AA seqDB search
MKAAVIESVGRAVVAEVPDPTPGPREVVVEVAACGLCGTDLHILQGEFAPKLPLVPGHEF
AGEVVGVGTQVTELAIGDRVAVDPSLYCYECRYCRTGHNNLCERWAAIGVTTAGGAARYA
AAPVANCVKLPEHVRTQDAALVEPLSCAVRGYDVLNSRLGAHILIYGSGTMGLMMLELAK
RTGAASVDVVDLNPDRLQTARRLGVSRAASGADELDRPQGWDVVVDATGNAGAIQDGLGR
VAKAGTFLQFGVADYATRVTIDPYRIYNQEITITGSMAVLHSFERAAELFANGVLDPEVF
ISDRIPLERYPEALEQFAAGVGRKIVVVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtcatcgagtccgtgggccgtgccgtcgtcgccgaggtcccggacccg
acgccagggccccgcgaggtggtcgtcgaggtggccgcctgcggactgtgcggcaccgat
ctgcacatcctccagggcgagttcgcgcccaagctgccgctcgtgcccgggcacgagttc
gcgggcgaggtggtcggggtcggcacccaggtcacggagctcgccatcggcgaccgggtg
gccgtggacccctccctgtactgctacgagtgccgctactgccgcaccggccacaacaac
ctgtgcgagcggtgggctgcgatcggcgtcacgacggcgggcggggcggcccggtacgcg
gcggcgcccgtggcgaactgcgtgaaactgcccgagcatgtgcgcacccaggacgccgcc
ctggtggagccgctgtcctgcgcggtacgcggctacgacgtcctgaactcccggctcggc
gcccacatcctgatctacggctccgggaccatgggcctgatgatgctggagctggccaag
cgcacgggcgcggcgagcgtggacgtggtcgacctcaaccccgaccggctgcagacggct
cgccgtctcggcgtctcgcgcgcggcgagcggcgcggacgaactggaccgcccgcagggc
tgggacgtggtcgtggacgcgaccggcaacgcgggggcgatccaggacggcctgggccgg
gtggcgaaggcggggaccttcctgcagttcggggtggccgactacgcgacgcgggtgacg
atcgatccgtaccgcatctacaaccaggagatcaccatcaccggttccatggcggtgctg
cacagcttcgagcgggcggccgagctgttcgcgaacggggtactggacccggaggtgttc
atcagcgaccgcatcccgctggagcggtaccccgaggcgctggagcagttcgcggccggg
gtggggcggaagatcgtggtggtgccctga

DBGET integrated database retrieval system