KEGG   Streptomyces griseochromogenes: AVL59_39180Help
Entry
AVL59_39180       CDS       T04729                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sgs  Streptomyces griseochromogenes
Pathway
sgs00010  Glycolysis / Gluconeogenesis
sgs00052  Galactose metabolism
sgs01100  Metabolic pathways
sgs01110  Biosynthesis of secondary metabolites
sgs01120  Microbial metabolism in diverse environments
sgs01130  Biosynthesis of antibiotics
Module
sgs_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AVL59_39180
   00052 Galactose metabolism
    AVL59_39180
Enzymes [BR:sgs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AVL59_39180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: ANP54824
UniProt: A0A1B1B7K3
LinkDB All DBs
Position
8999381..9000541
Genome map
AA seq 386 aa AA seqDB search
MELNRRTVIAGAAAAGIAATALGTGGAQAATGPGGRVPVKEPFGTLADGTKIYRWSLENG
GTRMKVLSYGGIVQTLEVPDRHGHHANVVAGFDDIADYVAKSPYFGALIGRYGNRIGKGR
FTLDGTSYQLSVNDGVNSLHGGTKGFDKHVWDVEPFTRGSEVGLHLYYTSADGEMGYPGT
LRAKVTYTLTRHGEWRIDYEATTDKATVVNLTSHVYWNLAGESSGTIEDHELRIAASRYT
PTDSGLIPTGELAKVAGTPFDFRRAKPIGRDIRAGHEQQVQAKGYDHNWVLDKGITARPE
HMATLRDPRSGRTLKIATDQPGLQFYSGNFLDGTLTGTGGRTYRQGDALCLETQHFPDSP
NHADFPSTVLRPGQTYRTTTIHTFGA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgtacggtcatcgcaggtgccgcggcggcgggcatcgccgccacc
gccctcggcacgggcggcgcccaggccgccaccggtccgggaggccgggtgccggtgaag
gaacccttcggcacactcgccgacggcacgaagatctaccgctggtcgctggagaacggc
ggcacccgcatgaaggtgctgtcctacggcggcatcgtccagaccctggaggtccccgac
cggcacggccaccacgccaacgtcgtcgcgggcttcgacgacatcgccgactacgtggcc
aagagcccctatttcggcgccctgatcggccgctacggcaaccgcatcggcaaggggagg
ttcaccctcgacggcacgagctaccagctgtccgtcaacgacggcgtgaacagcctgcac
ggcggtaccaagggcttcgacaagcacgtgtgggacgtcgagccgttcacccggggctcc
gaggtcggactccacctgtactacaccagcgccgacggcgagatgggctatccgggcacg
ctccgggcgaaggtgacgtacaccctcacccggcacggcgaatggcgcatcgactacgag
gccaccaccgacaaggcgaccgtcgtcaatctcaccagccacgtctactggaacctggcc
ggtgagagcagcggcacgatcgaggaccacgagctgcggatcgccgcgtcccgctacacc
ccgaccgactcgggcctgatcccgacgggcgagctggcgaaggtggccgggacccccttc
gacttccgccgcgccaagccgatcggccgggacatccgggccggccacgagcagcaggtg
caggccaaggggtacgaccacaactgggtcctggacaagggcatcaccgcgaggcccgag
cacatggcgaccctgcgcgacccgcgctccggccgcaccctgaagatcgccaccgaccag
ccgggcctgcagttctactccggcaacttcctcgacggcaccctcaccggcaccggcggc
cgcacctaccgccagggcgacgccctgtgcctggagacccagcacttcccggactcgccg
aaccacgcggacttcccgtcgaccgtgctgcggcccgggcagacgtaccgtacgacgacg
atccacacgttcggcgcctga

DBGET integrated database retrieval system