KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0468Help
Entry
SGGB_0468         CDS       T02018                                 

Gene name
prkC
Definition
(GenBank) serine/threonine protein kinase, bacterial
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Brite
KEGG Orthology (KO) [BR:sgt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgt01001]
    SGGB_0468 (prkC)
Enzymes [BR:sgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SGGB_0468 (prkC)
Protein kinases [BR:sgt01001]
 Serine/threonine kinases: Other
  Bacterial family
   SGGB_0468 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo RIO1 APH Kinase-like Pilus_CpaD FTA2 EOS1 PBP1_TM DUF4366 Fructosamin_kin CrgA YtpI Pkinase_fungal Pox_EPC_I2-L1 UL45 DUF2116 Orf78
Motif
Other DBs
NCBI-ProteinID: BAK27361
UniProt: F5WZA0
LinkDB All DBs
Position
483527..485404
Genome map
AA seq 625 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLAKDLILDNEEVAIKVLRTNYQTDQIAVARFQR
EARAMAELNHPNIVSIRDIGEEDGQQFLVMEYVDGSDLKKYIQDHAPLSNNEVVRIMEEV
LSAMTLAHQQGIVHRDLKPQNILLTKDGTVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIDENKNVP
QALENVVIKATAKRLSDRYASTFEMSRDLMTALSYNRSREPKLVFEDTENTKTLPKVTTS
TSVPSTTEQLLKKQKAAKEDKAATENKATKAKTKKKKSRRMFGTLMKIFFAVVIVAIAIF
TYLTLTSPSTVSVPDVAGSSLSEAKTTIKSSGLKVGTVHKVSSDTVESGYVIKTSPTAGS
SKKEGSSIDIYVSKGSSGFKIKDYTGQDYQTAVKDLVNNYGVSESQIEIEEVSTSDYDEG
VIISQTPSEGETFKVSGDDKITFKVAAESTVTMPNLTGYTYSEAIAALTALGVSSSHITV
YQADPNSSTGYVQVSSPSSTATVTAQTPYYGETLSGNVVLYLAADEEESSQAPSSSSSES
SESKESSSSSSSTDDSSSSTETSDE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcggatcctcaaatctatcggacgg
ggtggaatggcagatgtttatctggcaaaagatctcattcttgataatgaagaagttgcc
attaaggtgcttcggacgaattatcagactgatcaaattgccgtagcgcgtttccaacgg
gaagcgcgtgccatggcagaactgaaccatccaaatatcgtctcgattcgtgatattgga
gaagaagacggacagcaattcttagtaatggaatatgttgatggctcggacttgaaaaaa
tacattcaagatcatgctccgctttctaataatgaagttgttagaatcatggaagaagtc
ttatctgcgatgactttggcgcatcaacaaggaattgttcaccgtgatttaaaaccacaa
aatatcttattaaccaaagacggaactgttaaagttactgactttggtatcgccgtagcc
tttgccgaaacaagtttaacgcaaaccaattcaatgctaggtagtgtgcattatttatcg
cctgaacaagcacgtggttcaaaagcgactgttcaaagtgatatttacgctatggggatt
atgttgtttgaaatgttaacaggtcacatcccatatgatggcgattcagctgttaccatt
gcgcttcaacatttccaaaaaccacttccttccatcattgatgagaataaaaatgtgcca
caagcactagaaaatgttgttatcaaggcgactgcaaaacgtttaagtgaccgttatgcg
tcaacttttgaaatgagtcgtgatttgatgacggcactttcttacaaccgtagccgtgaa
cctaaacttgtttttgaagatactgaaaatacaaagacacttccaaaggtaacaacatca
acatctgttccttcaacgacagaacaactcttgaagaaacaaaaagcagctaaagaagat
aaagcagcaacagaaaacaaagcgactaaagctaaaacaaagaagaaaaaatcacgtcgt
atgttcggcacattgatgaaaatcttttttgcagttgtgattgtagctattgctatcttt
acttacttgacgttgacctcaccatcaaccgtgagtgttccagatgttgctggctctagt
ttatcagaagcaaaaacaacgataaaatcatcaggtcttaaagttggaaccgttcataaa
gtatcaagtgataccgttgagagtggttatgttattaagacaagtccaactgctggttca
tcgaaaaaagaagggtcatcaattgatatttacgtatcaaaaggctcatcaggattcaag
ataaaagactatacaggtcaagattatcaaacagccgttaaagatttggtcaataattac
ggtgtttcagagtcgcaaattgagattgaagaagtctcaacgtcagactatgacgaaggt
gttatcattagtcaaacgcctagcgaaggtgaaacctttaaggtaagtggcgatgataag
attacctttaaagtagccgcagaaagcacagtaacaatgccaaatctgacaggctatact
tattcagaagctattgctgccttgacggctctaggtgtgtcaagttcacatattacggtt
tatcaagccgacccaaattcttctacgggttatgtgcaagtaagctcaccatcttcaaca
gcaactgtcactgctcagacaccttattatggtgaaacgttaagtggtaacgtggtactt
tatctagcagctgatgaagaagaaagctcacaggcaccatcgtcatcaagctcagaatcc
tctgaatcaaaagaatcaagttcatcaagcagtagtacagatgacagtagctcatcgaca
gaaacaagtgatgaataa

DBGET integrated database retrieval system